Bitcoin Forum
June 29, 2022, 10:06:54 PM *
News: Latest Bitcoin Core release: 23.0 [Torrent]
 
  Home Help Search Login Register More  
  Show Posts
Pages: [1] 2 »
1  Local / Altcoins (Bahasa Indonesia) / [ANN]TwilightCoin - Decentralized Crowdfunding Platform for Anime Creators&Fans on: November 05, 2018, 10:45:41 PM




*** Platform Crowdfunding Terdesentralisasi ***

Ini merupakan platform crowdfunding terdesentralisasi yang memungkinkan studio (rumah produksi) animasi dan pembuat konten individu untuk mengumpulkan dana. Studio animasi dan pembuat konten individu bisa memperoleh hak untuk menerbitkan item digital dengan cara mendepositkan TWC (Twilight Coin) pada platform ini. Mereka menerbitkan item digital (DIT: Digital Item Token) yang terkait dengan masa depan mereka dan pekerjaan/karya sebelumnya dicatat pada blockchain serta mengumpulkan pendanaan melalui crowdfunding. Item digital yang dapat diterbitkan adalah autograf, gambar original, data audio, tiket masuk, dll. Selain itu lisensi penggunaan sekunder (SUT: Secondary Usage Token) dari pekerjaan/karyanya sendiri dapat diterbitkan dengan cara mendepositkan TWC. Lisensi penggunaan sekunder ini juga dapat dijadikan cara untuk mengumpulkan dana dengan menjualnya ke pengguna sekunder.


*** Permasalahan ***


* Permasalahan yang Saat ini terjadi dalam Sistem Komite Produksi

Diperlukan dana yang besar untuk memproduksi karya animasi. Dibutuhkan sekitar 10 sampai 15 juta JPY (Yen Jepang) untuk memproduksi animasi yang tayang di TV selama 30 menit, dan diperlukan sekitar 100 sampai 200 juta JPY ($ 0,9-1,8 juta) untuk memrpoduksi tayangan selama 30 menit untuk satu musim (tayang 13 minggu). Di Jepang mekanisme yang biasa dipakai untuk menjamin dana produksi ini disebut "sistem komite produksi". Ini adalah sistem untuk membuat berbagai karya dimana beberapa perusahaan seperti penerbit, agen periklanan, pembuat video, distributor berkumpul dan memberikan dana untuk mengorganisir komite produksi, selanjutnya dana didistribusikan ke studio animasi, perusahaan pemasaran, perusahaan produksi musik, pengisi suara, dll. Dalam mekanisme ini, studio animasi berperan mengirimkan produk ke komite produksi sebagai subkontraktor. Sistem ini memungkinkan perusahaan investasi untuk mengurangi jumlah investasi kepada satu komite produksi dan mendiversifikasi risiko dengan mendanai berbagai komite.

* Produksi Animasi Tidak Mampu Mengakomodir Aspirasi Pecinta Animasi

Dalam sistem komite produksi, sebuah komite produksi, pihak investor, memiliki inisiatif dalam produksi animasi, lalu studio animasi dan pembuat konten individu berperan mengirimkan karya yang dipesan kepada komite produksi. Dalam sistem ini, komite produksi, investor, cenderung menginstruksikan pembuatan animasi yang diterima oleh beberapa Influencer fanatik dengan daya beli yang tinggi atau yang bersikap sok tahu, sehingga mempersulit pembuat konten untuk memproduksi karya yang dapat diterima oleh banyak, yang benar-benar sesuai dengan keingingan pembuat konten. Akibatnya, perencanaan dan produksi diprioritaskan untuk memenuhi keinginan para fanatik ini dengan mengorbankan kebutuhan pecinta animasi secara umum.

* Penurunan Lingkungan Kerja Pembuat Konten dan Kurangnya Insentif

Sangat sulit memperkirakan jenis animasi apa yang akan menjadi blockbuster (mencapai sukses bessar) bahkan bagi perusahaan investasi dan komite produksi. Oleh karena itu, perusahaan investasi menghindari investasi besar dalam satu komite produksi, dan berinvestasi di banyak komite produksi yang berbeda untuk mengurangi risiko. Akibatnya, terjadi penurunan anggaran produksi untuk setiap karya, jam kerja yang lama untuk memenuhi target waktu singkat menjadi keharusan, dan lingkungan kerja para pembuat konten telah menurun. Selain itu, perusahaan produksi kecil yang tidak mempunyai banyak sumber keuangan tidak mampu mendapatkan hak atau privilege atas karya animasi mereka sendiri karena posisi mereka hanya sebagai subkontraktor bagi komite produksi. Oleh karena itu, meskipun produk tersebut sukses, studio dan pembuat konten individu tidak menerima imbalan yang layak mereka dapatkan dari biaya lisensi, dll., yang menempatkan mereka dalam lingkaran setan atas sebab penurunan lingkungan kerja ini.


*** Solusi ***


* Realisasi "Sistem Produksi Animasi C2C" oleh Proyek TWC

"Sistem Produksi Animasi C2C" merupakan cara baru untuk produksi animasi akan direalisasikan dalam proyek ini. Ini didasarkan pada platform crowdfunding terdesentralisasi yang mana studio animasi dan pembuat konten individu dapat mengumpulkan dana secara langsung dari pecinta animasi umum dengan cara menerbitkan dan memberikan item digital dan lisensi untuk penggunaan sekunder yang dicatat/direkam pada blockchain. Platform ini memungkinkan pembuat konten dan studio animasi untuk menerbitkan dan menjual item digital seperti autograf, gambar original, data audio, dan tiket masuk secara langsung ke pendukung mereka untuk mendapatkan dana. Dana yang terkumpul dapat digunakan untuk produksi animasi. Selain itu, lisensi untuk penggunaan sekunder dapat diterbitkan dan dikelola pada blockchain dengan memanfaatkan platform ini.

* Membuat Produk yang Diinginkan oleh Pecinta Animasi Umum (Pendukung)

Dalam platform ini, studio animasi dan pembuat konten individu merilis rencana karya animasi untuk pecinta animasi yang digunakan untuk penggalangan dana sebelum produksi dimulai. Akan ditentukan dana minimal yang diperlukan untuk produksi, dan dana yang terkumpul akan dikembalikan jika jumlah minimal ini tidak tercapai dalam periode penggalangan dana ini. Oleh karena itu, hanya karya dan pembuat konten yang didukung oleh banyak pecinta animasi yang akan berhasil dalam penggalangan dana tanpa terpengaruh oleh kelompok fanatik tertentu, yang akan mengarah pada produksi karya berkualitas tinggi yang diinginkan oleh pendukung umum. Selanjutnya, pembuat konten dapat memproduksi karya berdasarkan aspirasi pendukung karena perkembangan produksi akan dibagikan kepada pendukung secara berkala. Hasilnya, antara pendukung dan pembuat konten dapat terkoneksi secara langsung, dan C2C (Creator to Customer) dapat terbentuk.


* Memperbaiki Lingkungan Kerja Pembuat Konten dan Menjamin Insentif

Dengan menggunakan platform ini, studio animasi dan pembuat konten individu dapat membelanjakan dana yang dikumpulkan secara langsung dari pendukung dan pengguna sekunder, yang diharapkan dapat memperbaiki lingkungan kerja. Selain itu, karena lisensi sebuah karya adalah milik studio atau pembuat konten individu, fee lisensi dapat dikumpulkan melalui perilisan teatrikal, distribusi platform, penjualan souvenir resmi, dan pada saat karya dirilis. Reward yang diberikan secara langsung kepada studio atau pembuat konten adalah insentif yang besar bagi mereka dalam memproduksi karya yang sukses.









Thread Ann Resmi Di Sini




Saya hanya berperan sebagai penerjemah thread ANN dari proyek TwilightCoin dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

2  Local / Altcoins (Bahasa Indonesia) / 🚀【ANN+BOUNTY】【PRE-ICO】🚀 🌐 NOVAM: Keamanan Cyber Terdistribusi untuk IoT 🌐 on: November 01, 2018, 12:21:17 PM























Thread Ann Resmi Di Sini




Saya hanya berperan sebagai penerjemah thread ANN + Bounty dari NOVAM dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

3  Local / Altcoins (Bahasa Indonesia) / [ANN] INFLEUM - PLATFORM PENERBITAN MEREK BERBASIS BLOCKCHAIN on: September 13, 2018, 07:00:07 AM









_White_Paper_


_Model Penilaian_







Thread ANN Asli: Di sini



Saya hanya berperan sebagai penerjemah thread ANN, Whitepaper dan dokumen lain dari INFLUEN dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

4  Local / Altcoins (Bahasa Indonesia) / [ANN] [WHITELIST] [CFS] - Platform Desentralisasi ICO Pertama di Dunia on: September 11, 2018, 03:31:38 PM




















Saya hanya berperan sebagai penerjemah thread ANN dan Whitepaper dari CoinFast dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

5  Local / Altcoins (Bahasa Indonesia) / [ANN][ICO] QUANTOCOIN - BANK NYATA BERBASIS BLOKCHAIN PERTAMA on: September 04, 2018, 08:28:35 PM


QUANTOCOIN
Masa depan layanan keuangan

DTO SEDANG BERLANGSUNG
WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
REDDITGITHUBMEDIUMYOUTUBE

🔊    Thread ANN Resmi Quantocoin    🔊

Kampanye Bounti Resmi Quantocoin : Sebanyak 1 000 000 Token QTC (setara $1 000 000 USD) sedang menantimu!
https://bitcointalk.org/index.php?topic=4956093

========================================
TARGET ICO

💥 Softcap: $3 000 000 USD (tercapai) 💥
Hardcap: $70 000 000 USD
✈️✈️✈️ Terkumpul: $11 003 700 USD ✈️✈️✈️


   


JADWAL PENJUALAN TOKEN

Pre-Sale Pribadi: 18 - 30.11.2017 | Didistribusikan 1 856 000 QTCt | Terkumpul $1 230 000 USD
ICO: 01.12.2017 - 28.02.2018| Didistribusikan 16 460 000 QTCt | Terkumpul $9 803 700 USD

🌟🌟🌟 DTO: 01.07.2018 - 30.04.2019 | Harga : 1 QTCt = $1.2 USD 🌟🌟🌟

========================================

Bahasa Lainnya
(Link akan diperbaharui setelah diterjemahkan)
------------------
.• Cina : (ANN, Whitepaper)
• Arab : (ANN, Whitepaper)
• Jepang : (ANN, Whitepaper)
• Rusia : (ANN, Whitepaper)
• Korea : (ANN, Whitepaper)
• Spanyol : (ANN, Whitepaper)
• Vietnam : (ANN, Whitepaper )
• Jerman : (ANN, Whitepaper )




PERMASALAHAN
______________


  •   Pada saat ini sistem keuangan didukung oleh lembaga keuangan berskala besar yang menyediakan layanan keuangan. Ini meliputi bank, perusahaan asuransi, perusahaan kartu kredit, perusahaan pengiriman uang dll yang ketinggalan zaman (kuno) dan memiliki penetrasi yang lemah.

   •   Adopsi cryptocurrency ke kehidupan sehari-hari: Sekarang hampir tidak mungkin menggunakan cryptocurrency apapun untuk membayar barang, atau melakukan pengiriman dll. Selain itu, proses transaksi untuk cryptocurrency terhadap fiat praktis tidak ada:
     +   Keterbatasan kemampuan untuk melakukan pembayaran menggunakan cryptocurrency
     +   Kerugian dalam perdagangan akibat tingginya volatilitas dari pasar yang cepat
     +   Proses yang rumit dan mahal
     +   Menjual cryptocurrency sesuai permintaan akan mengakibatkan kerugian yang tinggi




SOLUSI
______________


Quantocoin telah mengembangan model generasi terbaru untuk masa depan layanan keuangan dan perbankan digital. Model ini menggunakan teknologi Blockchain yang dikombinasikan dengan smartphone, serta sistem identifikasi-bio terbaru yang akan memastikan keamanan dan perlindungan terhadap akun pengguna. Ini adalah proyek untuk mengembangkan masa depan dunia keuangan crypto. Tujuan utamanya adalah untuk mengintegrasikan dan menghubungkan QTC ke dalam dunia keuangan tradisional serta untuk membuat gerbang tunggal melalui platform QTC bagi pengguna, pedagang (trader), investor, dan lembaga keuangan dengan berbagai macam layanan tambahan.

Quantocoin merupakan platform untuk masa depan pendanaan yang dibangun di atas blockchain Waves. Ini akan mempercepat pertumbuhan dari orang yang tidak terjangkau layanan bank dengan menawarkan alat dan layanan yang hemat waktu dan sumber daya.




BAGAIMANA CARA KERJANYA
______________


Ekosistem QTC sebagai lingkungan kompleks yang menghubungkan semua layanan individual di satu tempat. Meskipun layanan individual benar-benar independen, kombinasi mereka membuat ekosistem yang simpel, jelas dan terpusat. Kepercayaan organisatoris dalam platform menyediakan layanan penambahan atau penghapusan melalui fitur drag dan drop (menarik dan meletakkan). Seluruh sistem dibangun pada satu titik akses, yang mana membuat platform QTC mudah diakses melalui akun klien.

Fungsi bank QTC:
   ➢   Dompet - Penukaran, transfer, pengiriman uang
   ➢   Cash (Uang tunai) Instan - Cryptocurrency untuk pengguna setiap hari
   ➢   Peminjaman dan Pembiayaan Mikro - Protokol peminjaman QTC
   ➢   Pembayaran Sosial - Inner chat dengan keamaan tinggi
   ➢   Portofolio Aset Crypto - Alogaritma manajemen portofolio tokenisasi
   ➢   Geofencing - Fungsi proximity (jarak) unik

Aplikasi Ponsel QTC:
Aplikasi ponsel QTC bisa diunduh melalui iOS atau Android dan pada ahirnya pelanggan dapat menggunakan cryptocurrency mayor untuk membayar barang atau layanan berbasis fiat secara instan, mudah, dan langsung pada tiap terminal POS dengan teknologi NFC, atau melalui QTCBeacon kami.
QTC akan memanfaatkan secara penuh fenomena global tanpa kontak ini, tetapi bukannya untuk saluran pembayaran tradisonal dengan mata uang fiat, QTC akan menggunakannya untuk cryptocurrency melalui smartphone pribadi.

Kami menggabungkan tiga teknologi terbaik di dunia: NFC, Kode QR and Beacon dalam satu aplikasi (aplikasi hybrid). Quantocoin dengan aplikasi ponsel QTC mengubah iPhone dan Android menjadi platform Perbankan yang canggih.








• Tidak diperlukan GPS dan penerimaan telepon
• Jangkauan proses yang luas dibandingkan dengan Near Field Communication (NFC)
• Tidak diperlukan perangkat keras Point of Sales (POS)
• Teknologi didukung oleh merk perangkat ponsel utama
           

Protokol Peminjaman - Aplikasi cash instan pertama
Protokol Peminjaman QTC merupakan langkah selanjutnya dari kesuksesan pengembangan platform QTC yang menyediakan uang tunai (cash)langsung yang didukung dengan cryptocurrency. Kontributor sekarang bisa menggunakan aplikasi ponsel QTC untuk memegang/menyimpan aset crypto mereka tanpa perlu menjualnya.
Pengguna akhir diperbolehkan untuk memanfaatkan semua aset crypto mereka (QTC, BTC, ETH dll) untuk mendapatkan uang tunai secara instan yang dapat mereka belanjakan melalui kartu pembayaran dan aplikasi ponsel QTC tanpa cash-tanpa kontak. Dalam periode peminjaman ini, portofolio aset kontributor digunakan sebagai jaminan, dikelola secara dinamis dan cepat, memberikan peluang untuk mendapatkan keuntungan dan pertumbuhan jangka panjang dari portofolio.


• Cash (Uang tunai) instan
• Uang tunai bisa diminta secara otomatis menggunakan aplikasi smartphonemu.
• Pembelian, Membelanjakan
• Aplikasi QTC memungkinkan untuk melakukan pembelian pada lebih dari 70 juta pedagang atau penarikan tunai di lebih dari 3,8 juta ATM di seluruh dunia. Ini mempunyai Potensi 5 miliar pengguna ponsel.
• Pendekatan yang reponsibel (bertanggung jawab) pada portofolio cryptocurrency
• Kontributor dapat terus memperoleh manfaat dari apresiasi pasar yang luar biasa sebagaimana terlihat pada tahu-tahun sebelumnya dan juga prediksi positif 2018.
• Menghasilkan uang meskipun kamu membelanjakannya.
• Pertumbuhan portofolio - Aset jaminan berkerja untukmu karena portofolio tersebut dikelola secara aktif
           





ROADMAP
______________


.
FEB 2016
Whitepaper mini - struktur hukum dan kerangka kerja (framework), menjalin kemitraan, kemitraan teknis yang aman
.TAHUN 2016
Arah strategi bisnis, mengelaborasi rencana proyek, lisensi, pembentukan rantai perusahaan

.
Q1 2017
Rencana pemasaran, rekrutmen orang-orang berbakat, perencanaan platform dan pengembangan alur rencana
.Q2 2017
Registrasi IP dan TM, framework pengaturan, rencana pelaksanaan kepatuhan, whitepaper

.
Q3 2017
Menetapkan dewan penasehat, kemintraan dengan bank dan penyedia likuiditas, pengembangan komunitas, pengenalan ambasador
.DES 2017
ICO

.
Q4 2017
Audit keamanan, pengembangan UI/UX, pengajuan untuk melisting pada exchange cryptocurrency mayor, peluncuran pasar baru
.Q1 2018
Pengajuan untuk melisting QTC pada exchange cryptocurrency mayor, peluncuran pasar baru (Asia, Timur Tengah, Afrika), pengujian platform

.
Q2 2018
Pengujian aplikasi versi pertama, pengembangan dan pengujian wallet, permohonan EMI, otorisasi PI di FCA
.Q3 2018
Memulai DTO, peluncuran aplikasi, pengembangan aplikasi penjual, pengujian protokol peminjaman

.
Q4 2018
Memulai pengiriman uang, dompet berfungsi secara lengkap, qtcBeacon pertama, otorisasi untuk beraktifitas dari FCA, penyerahan dokumen untuk memperoleh lisensi perbankan
.Q1-2 2019
Perluasan jaringan penjual, pengujian aplikasi hybrid, implementasi protokol peminjaman, robo-advisor, DTO berahir

.
Q3 2019
Memperoleh lisensi perbankan, integrasi dengan sistem swift
.Q4 2019
Implementasi aplikasi hybrid, fitur penjual berfungsi secara lengkap, peluncuran fasilitas exchange sendiri




RINCIAN TOKEN
______________


.Nama Token:Token Quantocoin
.Simbol:QTCt
.Platform:WAVES
.Tipe:Utilitas
.Total suplai:99 000 000 QTCt
.Softcap:$3 000 000 USD
.Hardcap:$70 000 000 USD
.Penjualan Token:18.11.2017 - 30.04.2019
.Pembayaran diterima:  ETH, BTC, Waves, fiat
.Harga:1 QTCt = $1.0 - 1.2 USD
.Minimal investasi:   100 QTCt
.Negara:UK
.Whitelist/KYC:KYC
.Wilayah yang dilarang:Korea Selatan



ALOKASI TOKEN
______________


.DTO  
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||   71.3%
.ICO  
|||||||||||||||||||   18.5%
.Tim  
||||||||   8.5%
.Penasehat  
|   1.3%
.Cadangan  
|   0.5%


DISTRIBUSI DANA
______________


.Pengembangan Platform  
|||||||||||||||||||||||||||||||||||||||||||||||||||||   53%
.Struktur hukum, regulasi, penasehat pajak  
|||||   5%
.Biaya untuk pengembangan SW  
|||||||||   9%
.Biaya perawatan  
||||   4%
.Manajemen dan Tim  
|||||||||||||||   15%
.Biaya Menjangkau Komunitas  
|||   3%
.Kampanye Bounti  
||||   4%
.Penelitian  
|||||||   7%



PENJUALAN TOKEN
______________


.
TAHAP

Pre-Sale Pribadi
ICO

         DTO          
DURASI

18 - 30.11.2017
01.12.2017 - 28.02.2018

            01.07.2018 - 30.04.2019            
TOKEN

1 856 000 QTCt
16 460 000 QTCt

      70 000 000 QTCt      
TERKUMPUL

$1 230 000 USD
$9 803 700 USD

      -      



TIM INTI
______________

Tim inti kami terdiri dari berbagai ahli yang berpengalaman luas pada TI, teknologi blockchain, pemasaran dan model bisnis. Selain itu, orang-orang kami merupakan veteran di industri keuanan tradisional, dengan pengalaman lebih dari 25 tahun dalam trading online, FX dan perbankan pribadi. Ide QTC lahir dari perencanaan jangka panjang dan praktik beberapa tahun.

Konsultan eksternal kami bekerja pada sektor keuangan dan teknologi. Bagian penting dari tim kami adalah departeman keamanan, tempat dimana kami bekerja dengan pimpinan industri seperti Incapsula atau Checkpoint Infinity.



Alexander
Co-Founder

 
   
 
   

Anthony
Penasehat hukum dan kepatuhan

 
   
 

 
   
 
   
 
   
 



 
   
 


AMBASSADOR
______________


 
   
 
   
 



DIPUBLIKASIKAN PADA
______________

         

         

         



MITRA
______________

     

     

     

     



KAMPANYE BOUNTI
______________


Quantocoin menginginkan terjadinya proses kolaboratif. Dan kami membutuhkan dukungan untuk mensukseskan ICO ini. Jadi, anda untung, kami utung. Sebuah tim yang terdiri dari berbagai ahli profesinal telah mendedikasikan sebagian besar waktu dan pengetahuan mereka untuk mewujudkan hal ini - dan kami terus melakukannya. Dengan bergabung dalam kampanye bounti, kamu dapat menjadi bagian dari proyek Quantocoin.

Siapapun bisa ikut ambil bagian - DTO dimulai pada tanggal 01 Juli, 2018. Kami akan mengalokasikan 1 000 000 QTCt yaitu token QTC untuk beberapa bounti, yang akan kami distribusikan untuk semua orang yang mendukung pada sebelum dan selama DTO.

KESELURUHAN BOUNTI: 1 000 000 QTCt

 
      +   Airdrop: 10%
     100 000 QTCt ~ $100 000 USD

+   Kampanye Terjemahan: 5%
     50 000 QTCt ~ $50 000 USD
 
+   Kampanye Konten: 20%
     200 000 QTCt ~ $200 000 USD

+   Meetup: 5%
     50 000 QTCt ~ $50 000 USD
      +   Kampanye Facebook: 20%
     200 000 QTCt ~ $200 000 USD
 
+   Kampanye Twitter: 20%
     200 000 QTCt ~ $200 000 USD

+   Kampanye Forum: 20%
     200 000 QTCt ~ $200 000 USD





Masa depan layanan keuangan

DTO SEDANG BERLANGSUNG
WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
REDDITGITHUBMEDIUMYOUTUBE

*Formatting by MS Support



Saya hanya berperan sebagai penerjemah thread ANN dari QUANTOCOIN dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

6  Local / Altcoins (Bahasa Indonesia) / [ANN] THREAD PENGUMUMAN RESMI INTEGRITY.ONE!! on: August 30, 2018, 12:29:58 PM
THREAD PENGUMUMAN (ANN) RESMI INTEGRITY.ONE!
[ Website | Whitepaper | Telegram | Twitter | Facebook ]




























Saya hanya berperan sebagai penerjemah thread ANN dan Whitepaper dari INTEGRITY dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

7  Local / Altcoins (Bahasa Indonesia) / [ANN + BOUNTY][Pre-ICO] Libereum - Sepak Bola + Blockchain ⚽️🏆 on: August 29, 2018, 08:16:58 PM








Libereum (LIBER) merupakan token ERC20 yang berfokus awal pada pembangunan jaringan pengguna di industri olahraga - lebih spesifik lagi, klub sepak bola (atau klub soccer, seperti yang dikenal di AS).

Misi tahap pertama sangat mudah: mengakuisisi klub sepak bola di salah satu divisi olahraga terkemuka di Eropa. Kami dengan seksama mengamati perkembangan klub Red Bull (RB Leipzig dan Red Bull Salzburg) dan percaya bahwa menggabungkan Libereum dengan olahraga akan membuat cryptocurrency menjadi mainstream. Dengan senang hati kami mengatakan bahwa saat ini kami sedang dalam pembicaraan dengan empat klub untuk mengakusisi kepemilikan.





Setelah Libereum memperoleh kepemilikan klub, kami akan menggulirkan tahap selanjutnya. Libereum kemudian akan diperkenalkan kepada penggemar dan sponsor klub. Setelah perkenalan ini, kami akan bergerak maju mempersiapkan Libereum sebagai satu-satunya pilihan pembayaran untuk tiket, makanan dan minuman, merchandise (produk dagangan klub), paket sponsor, transfer keluar serta segala sesuatu di dalam dan sekitar stadion yang belum kami sebutkan.












Saya hanya berperan sebagai penerjemah thread ANN, Whitepaper dan dokumen lain dari Libereum dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

8  Local / Altcoins (Bahasa Indonesia) / [ANN] ITRUE - INSTANT ACCESS TO CONTROLLED GAINS WITH DEVICE-FREE TECHNOLOGIES on: August 07, 2018, 09:28:08 PM




Saya hanya berperan sebagai penerjemah thread ANN dari iTrue dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

9  Local / Altcoins (Bahasa Indonesia) / 💰💲[BOUNTY][X-Block][$3,600,000]Blockchain 4.0 global pertama💲💰 on: August 07, 2018, 01:26:35 PM


————————————————————————————————
IKUTI KAMI
————————————————————————————————


                           



————————————————————————————————
Apa itu X-Block?
————————————————————————————————


Sebagai representasi yang luar biasa dari rantai publik di era Blockchain 4.0, X-Block merupakan rantai publik global pertama yang dibangun pada kerangka komputasi Fog, bertujuan menciptakan layanan yang mudah digunakan (user-friendly), eco-blockchain ringan yang terbuka dan nyaman.

Mengandalkan kerangka komputasi Fog, X-Block dapat memanfaatkan berbagai perangkat berbeda (termasuk komputer pribadi, smartphone, router, dll.) Untuk membentuk mesin komputasi terdesentralisasi. Dengan kreatif merancang "Galaxy Super-Contract", hal itu memungkinkan smart contract untuk secara maksimal meminta teknologi eksklusif komputasi Fog yang kuat. Sementara itu, sumber daya komputasi dari peralatan di sekitarnya dapat diintegrasikan melalui X-Block. Ini akan lebih memanfaatkan blockchain untuk diintegrasikan ke dalam proses teknologi sehari-hari. Seperti kecerdasan buatan (AI) , data besar dan Internet of Things. Dengan demikian, era blockchain cerdas dapat mengantarkan untuk mempromosikan aplikasi teknologi blockchain dalam kehidupan sehari-hari.

X-Block berkomitmen untuk membangun ekosistem blockchain yang lengkap dan X-Block telah membangun X-Change bersama dengan komputasi Fog X-Block dan peralatan blockchain untuk menyelesaikan ekosistem token. X-Change merupakan sebuah pertukaran komunitas-otonom yang menggabungkan token X-Block dengan perdagangan dan penambangan.


————————————————————————————————
Alokasi Bounti
————————————————————————————————


Kami mengundangmu untuk berpartisipasi dalam kampanye bounty kami. Tim X-Block menawarkan hingga 250.000.000 token. Ini setara dengan $ 3,600,000.




————————————————————————————————
Peraturan Umum
————————————————————————————————


1.Tidak ada pembatasan terhadap kewarganegaraan dan wilayah. Siapa pun dapat mengambil bagian dalam program ini.
2.Pengguna terdaftar di website resmi dapat berpartisipasi dalam kegiatan. Harap sebisa mungkin mengisi informasi yang benar dalam proses registrasi.
3.Semua peserta program bounti diharapkan bergabung dalam grup Telegram X-Block:t.me/XblockOfficial, sehingga berhak untuk menerima hadiah bounti.
4.Peserta harus menggunakan email untuk mendaftar di website resmi:https://x-block.io/untuk berpartisipasi dalam kampanye boounti. Token yang diperoleh oleh peserta kampanye juga dapat dilihat di website resmi.
5.Bounti akan berjalan sampai akhir Penjualan Token.
6.Semua hadiah akan dihitung setelah ICO selesai. Setelah ICO selesai, kami akan menghubungimu melalui email dan mendistribusikan Token X-Block yang telah kamu peroleh. Harap isi alamat ERC20 dengan benar sebelum periode ICO selesai untuk memastikan bahwa kamu dapat menerima hadiah Token X-Block secara normal. Masukkan alamat dompet pribadimu di sistem sehingga kami dapat mentransfer token hadiah ke dompet pribadimu.
7.Kami berhak untuk menghapusmu jika kami pikir kamu belum jujur dengan pekerjaanmu.
8.Kami berhak untuk mengubah aturan kampanye bounti.
9.Untuk pertanyaan apa pun terkait kampanye bounti, silakan hubungi kami melalui: bounty@x-block.io
10.Silakan gunakan akunmu sendiri untuk berpartisipasi dalam program ini. Peserta yang ditemukan menggunakan akun media sosial orang lain untuk berpartisipasi dalam kampanye akan didiskualifikasi dari semua kegiatan dan hadiah.




————————————————————————————————
Pendaftaran
————————————————————————————————


1.Video Original
Buatlah Video Asli, kamu dapat memperoleh 100 ~ 3000 stake setiap video.
• 100-999 follower:100 stake
• 1000-4999 follower:800 stake
• 5000-9999 follower:1500 stake
• 10001+ follower:3000 stake
CATATAN: Pekerjaan dapat dilakukan 1 kali per dua hari.
2.Follow Kami Di Youtube
Follow Halaman Resmi X-Block di Youtube, unggah screenshoot, kamu dapat memperoleh 100 stake.
Youtube Resmi X-Block:YOUTUBE
CATATAN: Pekerjaan dapat dilakukan 1 kali sebelum ICO berahir.
3. Upvote di Youtube
Upvote video resmi X-Block di Youtube, unggah screenshoot, kamu dapat memperoleh 50 stake setiap video.
Youtube Resmi X-Block:YOUTUBE
CATATAN: Pekerjaan dapat dilakukan 1 kali untuk setiap video resmi.


————————————————————————————————
Peraturan
————————————————————————————————


1.Video YouTube minimal harus 2 menit. Kamu minimal harus memiliki 100 follower organik.
2.Semua nama video harus menyertakan X-Block, Blockchain.
3.Deskripsi video atau konten perlu menyebutkan nama proyek X-Block X-Block, website resmi proyek x-block.io, link grup telegram proyek t.me/XblockOfficial, memperkenalkan kelebihan proyek, dan pembuat video memahami tentang proyek X-Block. (sekitar 50 kata)
4.Video tidak dapat dihapus sebelum proyek tercapai, jika tidak, stakenya tidak akan dihargai.
5.Maksimal 1 video per dua hari
6.Semua video yang dirilis harus sesuai izin penggunaan dan penyebaran resmi X-Block.
7.Video harus original. Pengguna yang menyalin video lain akan didiskualifikasi.
8.Ini adalah proyek berkualitas tinggi, dan kami mendorong diskusi dan pendapat yang membangun. Apapun yang tidak merepresentasikan proyek / klaim palsu tidak akan diizinkan dan stakenya tidak akan diberikan.




————————————————————————————————
Pendaftaran
————————————————————————————————


1.Avatar & Teks Bitcointalk
Pakailah avatar dan teks pribadi kami, kamu dapat memperoleh 5 ~ 40 stake perminggu.
• Junior Member : 5 stake
• Member: 10 stake
• Full Member: 15 stake
• Sr. Member: 25 stake
• Hero Member : 35 stake
• Legendary: 40 stake
Kamu bisa memperoleh Avatar dari sini:AVATAR
Teks pribadi: X-Block.io
CATATAN: Pekerjaan dapat dilakukan 1 kali setiap minggu.
2.Membalas Postingan Kampanye Bounti Bitcointalk
Membalas postingan kampanye bounti, maksimal 1 kali per hari, kamu dapat memperoleh 2 ~ 16 stake setiap hari.
• Junior Member : 2 stake
• Member: 4 stake
• Full Member: 6 stake
• Sr. Member: 10 stake
• Hero Member : 14 stake
• Legendary: 16 stake
Link postingan Kampanye Bounti:https://bitcointalk.org/index.php?topic=4836075.msg43626184#msg43626184
CATATAN: Pekerjaan dapat dilakukan 1 kali setiap hari.
Cara mendapatkan link —— kamu dapat mengeklik balasanmu # XX , lalu salin link di browser




————————————————————————————————
Peraturan
————————————————————————————————


1.Peserta minimal harus Jr. Member.
2.Setiap peserta harus memakai avatar dan teks pribadi kami. Dan harus dipasang sampai stakenya dihitung setiap minggu, jika tidak, kamu tidak akan menerima hadiah token.
3.Multi akun akan dilarang. Spam tidak diizinkan. Jika ditemukan, peserta akan dilarang dari kampanye bounti lainnya.
4.Membalas posting minimal harus 30 karakter
5.Jangan posting tanpa menggunakan signature kami, atau kamu akan ditolak.
6.Kami akan memeriksa setiap posting dari setiap peserta.
7.Red trust tidak diizinkan untuk bergabung dengan kampanye ini. Jika kamu menerima Red trust saat periode kampanye, kamu akan ditendang.




Undang teman untuk mendaftar kampanye bounti, ketika teman menyelesaikan pendaftaran di website resmi x-block.io, kamu dapat memperoleh 50 stake atau lebih.
• Pengundang mendapat 50 stake / orang
• Terundang bergabung dengan kampanye, maka pengundang mendapat 5% dari stakenya (penghargaan berdasarkan kegiatan) dari terundang.
CATATAN:
Teman belum terdaftar kampanye bounti
Kamu dapat berbagi langsung dengan teman atau menyalin link ke teman. Sistem kami dapat secara otomatis mengenali bahwa kamu telah mengundang teman ini.




————————————————————————————————
Pendaftaran
————————————————————————————————


1. Follow dan like Facebook
Follow dan Like Facebook resmi X-Block, unggah screenshot, kamu bisa mendapatkan 100 stake.
Link Facebook X-Block: FACEBOOK
CATATAN: Pekerjaan dapat dilakukan 1 kali sebelum ICO selesai.
2. Membalas posting di Facebook
Balas postingan resmi X-Block dalam 4 hari di Facebook, unggah screenshot, kamu dapat memperoleh 50 stake setiap balasan.
Link Facebook X-Block: FACEBOOK
CATATAN: Pekerjaan dapat dilakukan 2 kali setiap hari.


————————————————————————————————
Peraturan
————————————————————————————————


1.Peserta harus memfollow dan menyukai halaman Facebook X-Block: FACEBOOK
2.Akun Facebook harus original. Akun palsu, mati, tidak aktif dan bot tidak akan diterima.
3.Bergabung dengan banyak akun tidak diperbolehkan. Pengguna yang ditemukan menggunakan multi akun akan didiskualifikasi.
4.Syarat dan ketentuan bisa diubah atau ditambah.
5.Nama pengguna tidak boleh berisi kata-kata seperti “ICO”, “bounty”, “bounty hunter”, “cryptocurrency” dan seterusnya. Avatar harus berisi foto aslimu. Jumlah postingmu tidak boleh melebihi 100 per minggu. Kalau tidak, kamu akan didiskualifikasi. Jika kamu tertangkap mengikuti kembali, kamu akan segera dilarang.




————————————————————————————————
Pendaftaran
————————————————————————————————


Artikel Original
Posting Artikel Original, kamu dapat memperoleh 1.000 hingga 20.000 stake setiap artikel.
• 100-1000 follower:ditolak - 0 stake; diterima - 1000 stake
• 1001-10000 follower:ditolak -0 stake; diterima - 2000 stake
• 10001-100000 follower:ditolak - 0 stake; diterima - 4000 stake
• 100001-500000 follower:ditolak -0 stake; diterima - 8000 stake
• 500001+follower:ditolak -0 stake; diterima - 20000 stake.
CATATAN: Pekerjaan dapat dilakukan 1 kali setiap hari.


————————————————————————————————
Peraturan
————————————————————————————————


1.Artikelmu harus memiliki standar yang tinggi dan tata bahasa yang benar.
2.Medium dan tumblr akan diterima.
3.Label artikel harus berisi minimal 3 label berikut: #XBlock, #Blockchain, #Crypto, #ether, #ethereum, #bitcoin ,#cryptocurrency ,#ICO , #tokensale
4.Kamu harus difollow oleh setidaknya 100 pengguna
5.Maksimal 1 per hari. Panjangnya harus 500 kata atau lebih.
6.Artikelmu harus unik. Ini TIDAK BISA dengan artikel hasil copi paste. Artikel harus asli. Jika tidak, pengguna akan didiskualifikasi.
7.Ini harus ditulis dalam bahasa Inggris.
8.Artikel perlu berisi link resmi berikut:
Website:https://x-block.io/
Telegram:t.me/XblockOfficial
Twitter:https://twitter.com/XBlockOfficial
9.Penulis artikel harus meninjau dokumen resmi untuk memastikan deskripsi akurat dari X-Block.
10.Artikel perlu menjelaskan kelebihan dari X-Block.
11.Artikel harus dipoting di website yang terbuka untuk siapapun
12.Kami berhak untuk mempertimbangkan artikel yang tidak memenuhi syarat untuk kampanye ini, tanpa memberikan alasan apa pun.





————————————————————————————————
Pendaftaran
————————————————————————————————


1.Follow Kami Di Twitter
Silakan follow Halaman Resmi X-Block di TWITTER,kamu dapat memperoleh 100 stake.
2. Retweet Di Twitter
Retweet setiap tweet dari Twitter resmi X-Block dalam 4 hari, kamu dapat memperoleh 75 ~ 600 stake.
• 50-100 Follower:75 stake
• 101-2000 Follower:150 stake
• 2001+ Follower:300 stake
CATATAN: Pekerjaan dapat dilakukan 2 kali setiap hari.


————————————————————————————————
Peraturan
————————————————————————————————


1.Follow X-Block di Twitter:TWITTER
2.Hanya akun twitter dengan lebih dari 50 follower yang diizinkan.
3.Jangan RT dan like tweet yang merupakan jawaban bagi pengguna lain.
4.Tweet / retweet, peserta harus segera mengambil stake, jika tidak, mungkin tidak berhasil.
5.RT harus menambahkan setidaknya 2 hashtag ini #XBlock #Blockchain #Crypto #ether #ethereum #bitcoin #cryptocurrency #ICO #tokensale
6.Jangan RT dan like tweet yang lebih dari empat hari.
7.Audit twittermu (https://www.twitteraudit.com/) skor minimal harus 85% dan hanya follower nyata dari audit terakhir yang akan dihitung.
8.Kami berhak untuk tidak mempertimbangkan akun Twittermu yang memenuhi syarat untuk kampanye ini, bahkan jika kamu memenuhi syarat.




————————————————————————————————
Pendaftaran
————————————————————————————————


Terjemahan
Terjemahkan ANN dan Whitepaper kami serta proofreading,kamu dapat memperoleh 240 ~ 4000 stake.
• Terjemahan ANN (termasuk kampanye:800 stake
• Proofreading ANN:240 stake
• Terjemahan Whitepaper: 4000 stake
• Proofreading Whitepaper: 1200 stake
Link Whitepaper X-Block:https://x-block.io/xblockfile/X-blockWhitepaper.pdf
CATATAN: Silakan baca Peraturan.


————————————————————————————————
Peraturan
————————————————————————————————


1.Terjemahan meliputi:Whitepaper: https://x-block.io/xblockfile/X-blockWhitepaper.pdf ,ANN
2.Kami akan meminta kamu untuk menerjemahkan thread ANN kami dan memoderasinya hingga program berahir. Kami juga mengharapkan kamu untuk menerjemahkan whitepaper.
3.Kami mengharapkan teks ditulis dan dikoreksi oleh manusia, terjemahan harus berkualitas tinggi, jika kami mengetahui bahwa kamu telah menggunakan alat penerjemah (misalnya Google Translate), kamu akan dilarang dari semua kampanye.
4.Satu orang hanya dapat memilih satu bahasa untuk diterjemahkan.
5.Jangan mendistorsi makna teks dan publikasi.
6.Jangan mendistorsi esensi atau struktur. Informasi harus sepenuhnya diterjemahkan.
7.Bahasa lokal harus diperbarui secara teratur. Lacak pembaharuan konten dari sumber resmi , jika tidak, jumlah hadiah akan berkurang
8.Kami hanya mencari terjemahan dalam beberapa bahasa berikut: Jepang, Korea, Cina, Vietnam, Spanyol, Perancis, Italia, Belanda, Rusia, Portugis, Indonesia, India, Arab.
9.Setelah kamu memesan terjemahan thread ANN, pemesanan ini berlaku selama 2 hari.
10.Setelah kamu memesan terjemahan whitepaper, pemesanan ini berlaku selama 7 hari.
11.Jika kamu tidak dapat menyelesaikan tugas dalam waktu yang diberikan kepadamu, kami akan menugaskan kepada penerjemah baru.




————————————————————————————————
Pendaftaran
————————————————————————————————


1.Follow Kami Di Reddit
Silakan follow Halaman Resmi X-Block di reddit, unggah screenshoot, kamu bisa mendapatkan 100 stake.
Reddit:REDDIT
2.Upvote di Reddit
Upvote setiap pos dari Reddit Resmi X-Block dalam waktu 4 hari, unggah screenshoot, kamu dapat memperoleh 20 stake.
CATATAN: Pekerjaan dapat dilakukan 2 kali setiap hari.




————————————————————————————————
Pendaftaran
————————————————————————————————


Penyebaran di Telegram
Sebarkan konten dalam grup Telegrammu tentang X-Block dan unggah screenshoot untuk mendapatkan beberapa token.
• 100-249 member:10 stake/ post
• 250-749 member:15 stake/ post
• 750-2499 member:20 stake/ post
• 2500+member:30 stake/ post
CATATAN:
Hingga 1000 token per minggu per akun
'Konten Sebaran‘:
X-Block is the first global public chain built on the Fog computing framework, which aims at creating a user-friendly, convenient and open light Eco-Blockchain.
Website: https://x-block.io/
Telegram: t.me/XblockOfficial
Twitter: https://twitter.com/XBlockOfficial
Medium: https://medium.com/@xblockofficial
Facebook: https://www.facebook.com/XBlockChain/


————————————————————————————————
Peraturan
————————————————————————————————


1.Sebarkan konten dalam grup Telegrammu tentang X-Block dan dapatkan beberapa token
2.Maksimal 1 postingan setiap dua hari untuk tiap grup (aturan ini diperlukan, karena viewer tidak akan menerima spam setiap hari di chanel yang baik terhadap buruknya nilai iklan).
3.Kamu harus Tetap berada dalam grup sampai ICO berahir untuk menerima stakemu.
4.nggah screenshoot (gif, jpg, jpeg, bmp, png) dan laporkan di website kami




————————————————————————————————
Pendaftaran
————————————————————————————————


1.Hadiah gambar
• gagal diaudit:0 stake;
• berhasil diaduit: 30 stake/gambar
2.Hadiah GIF
gagal diaudit:0 stake;
berhasil diaduit: 60 stake/gif


————————————————————————————————
Peraturan
————————————————————————————————


1.Buat gambar dan GIF kreatif yang terkait dengan X-Block.
2.Semua gambar dan GIF harus sesuai izin penggunaan X-Block.
3.Maksimal 10 gambar dan 10 GIF per hari, yang berarti setiap orang dapat mengunggah 20 foto per hari.
4.Kamu harus menggunakan email untuk mendaftar di website resmi, untuk berpartisipasi dalam kampanye ini.
5.Kamu harus mengirim gambar ke admin telegram resmi X-Block, melalui telegram, dan pada saat yang sama beri tahu alamat email bountimu, admin akan mencatat hadiah yang berhak kamu dapatkan.



Saya hanya berperan sebagai penerjemah thread BOUNTI dari X-Block dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

10  Local / Altcoins (Bahasa Indonesia) / [ANN] flyCARE - Medis, kesehatan dan perawatan pribadi untuk semua orang on: June 06, 2018, 07:39:49 PM


         




Medis, kesehatan dan perawatan pribadi untuk semua orang, kapanpun, dimanapun di seluruh dunia.
Hal ini tidak lagi menjadi sebuah utopia. Ini adalah visi dari flyCARE.


Platform ini bertujuan untuk menjadi solusi akses yang mudah
ke layanan, penawaran all-in-one yang mencakup berbagai layanan:
fisioterapis, penata rambut, dokter gigi, spesialis pedikur
contohnya - semua itu di rumah, simpel. flyCARE bertujuan untuk
"terbang" (fly) ke layanan klien, menawarkan, melalui solusi
all-in-one dan lokal, memotivasi dan penyedia layanan yang siap
digunakan, berbagai layanan (CARE) menggabungkan kenyamanan,
ergonomi dan teknologi.

BRUNO LAMOUREUX,
PENDIRI DAN CEO, FLYCARE
















         



Thread Ann Asli di sini



Saya hanya berperan sebagai penerjemah thread ANN dan Whitepaper dari flyCARE dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

11  Local / Altcoins (Bahasa Indonesia) / ANN[ICO]Peluncuran Token GLOBAL RISK EXCHANGE(GRE)🎯 TERJUAL HABIS 🎯⭐️ on: May 19, 2018, 04:57:54 PM
Peluncuran Token GLOBAL RISK EXCHANGE (GRE)


Global Risk Exchange (atau "GRE") merupakan sebuah platform berbasis blockchain,terdesentralisasi dan marketplace pertukaran resiko global terbuka, dengan tujuan membantu setiap individu, perusahaan dan organisasi untuk dengan mudah memperdagangkan atau melindungi risiko mereka.

Dengan token RISK, setiap pengguna cukup menggunakan aplikasi atau hyperlink kami untuk memperdagangkan berbagai jenis kontrak manajemen risiko seperti pergerakan harga Altcoin, kondisi cuaca (pasar) , kualitas kredit dari semua obligasi yang diperdagangkan secara publik, harga komoditas, dan sebagainya.


Website  |  Telegram  |  Twitter  |  Facebook




Penjualan umum (Crowdsale) kami akan dimulai besok melalui exchange LeekICO. Periksa rinciannya di sini: https://www.facebook.com/notes/gre-foundation/ico-global-risk-exchanges-revolution-on-leekicorisk-sharing-by-everyone-with-eve/2149158678654474/



Global Risk Exchange juga memenangkan Penghargaan Lain dalam pertemuan Blockchain yang baru saja berakhir di China: https://medium.com/@foundation.gre/gre-being-awarded-best-of-blockchain-financial-innovation-award-in-the-7th-china-fintech-summit-f6b12505b7d2/



DIMULAI 20 Mei 2018 pukul 12:00PM(UTC+8)
BERAHIR 15 Agustus 2018 pukul 12:00PM(UTC+8)

Penawaran ini akan terbuka untuk umum secara global kecuali untuk warga dari China dan AS.





  • Target/Cap Token: Selama penjualan token, akan ada soft cap yang ditetapkan sebesar 300.000.000 token RISK. Hard cap adalah 1.500.000.000 token RISK. 10% dari keseluruhan token akan dialokasikan dalam pre-sale ini

Harga Token saat penerbitan:  Setara dengan 0,000008 - 0,00001 ETH, tergantung pada tanggal pembelian

Bentuk pembayaran yang diterima: ETH

Link Website : https://www.gref.io/

Download Aplikasi Mobile kami di sini: https://www.pgyer.com/greappGRE



Thread Ann Asli di sini



Saya hanya berperan sebagai penerjemah thread ANN, thread Bounti dan Whitepaper dari Global Risk Exchange dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

12  Local / Altcoins (Bahasa Indonesia) / [ANN][ICO] 💣 OctoBit.IO - Dompet Online & Jaringan Iklan yang siap digunakan on: May 08, 2018, 10:23:57 PM



Saya hanya berperan sebagai penerjemah thread ANN dan thread Bounti dari OctoBit.io dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

13  Local / Altcoins (Bahasa Indonesia) / 🔥 [ANN] [PRE_SALE] 🔥 Stoxum - Exchange hibrid terdesentralisasi on: May 06, 2018, 07:37:39 PM
Karena dev tidak aktif di thread utama, maka untuk menghindari postingan spam, thread ini saya kunci.
Untuk semua pertanyaan silakan langsung menuju ke group telegran (https://t.me/stoxum), terima kasih.


Kampanye Bounti sebanyak 750.000 STM dimulai! Bergabunglah sekarang Bounti


ICO SELESAI! Terima kasih semuanya

https://stoxum.org



Stoxum merupakan sebuah solusi bisnis yang unik dengan bantuan kepada perusahaan yang akan meluncurkan exchange cryptocurrency terdesentralisasi mereka sendiri dalam beberapa klik. Ekosistemnya terdiri dari bagian utama yang sangat efisien dan keamanan exchange crypto hybrid serta solusi Whitelabel, yang disatukan oleh sekumpulan perintah tunggal untuk memastikan likuiditas semua situs.

Seluruh pemegang token STM berhak menerima dividen (pembagian hasil) 100% dari seluruh pendapatan pada ekosistem Stoxum. Selama periode ICO akan didistribusikan diantara investor sebanyak 100% emisi (200 juta token).






PENJUALAN UMUM terdekat: 10.05.2018 - 20.05.2018:
Pre-Sale TAHAP 1 (bonus +25%)


PERIODE PENJUALAN TOKEN:


30.04.2018 — 05.05.2018: Pre-sale Tutup (+30%)
10.05.2018 — 20.05.2018: Pre-sale tahap 1 (+25%)
25.05.2018 — 06.06.2018: Pre-sale tahap 2 (+15%)
10.06.2018 — 17.06.2018: Pre-sale tahap 3 (+5%)
20.06.2018 — 25.06.2018: Pre-sale tahap 4 (+3%)

01.07.2018 — 10.08.2018: ICO



Harga token tetap
1 STM = 0.00002 BTC
Menerima BTC, ETH, LTC, BCH dan XRP


Emisi
200 000 000
Seluruh token yang tidak terjual akan dihancurkan. Tidak ada kemungkinan penambangan. Tidak ada emisi tambahan.


Softcap
$2 000 000


Hardcap
$30 000 000



Distribusi:

10% – Penasihat, bounti, bug-bounti
40% – Pengembangan
50% – Pemasaran




Permasalahan

Dalam situasi saat ini, kami menemukan 2 masalah: kompleksitas penerapan teknis produk keuangan untuk bekerja dengan cryptocurrency dan likuiditas dalam satu exchange.

Pada saat ini CoinmarketCap telah menempatkan lebih dari 10k platform trading - 95% diantaranya memiliki likuiditas yang rendah, dan karena itu tidak dapat memberikan layanan berkualitas tinggi kepada penggunanya. Dalam lingkungan yang kompetitif dan berkembang seperti itu, di mana sumber daya memiliki interface trading yang mirip dan menawarkan alat trading yang sama - sulit untuk menaklukkan pasar.

Namun demikian, volume trading pada platform biasanya berbanding lurus dengan jumlah pengguna terdaftar dan aktif, membawa kami pada gagasan yang mengetahui harga untuk menarik satu pengguna, kami dapat membangun model bisnis dengan akurasi tinggi. Itu, sebagai akibatnya, membawa kami pada gagasan bahwa untuk merebut pasar - kami hanya butuh uang untuk menarik pengguna.

Namun situasi yang umum adalah kamu memiliki tim teknis untuk melaksanakan proyek dan tidak punya uang untuk mengembangkannya, atau kamu memiliki uang, tetapi tidak mempunyai pengetahuan teknis.






Bagaimana kami mengatasi ini?


Dividen sebagai sebuah metode pemasaran sosial

Jumlah dividen = 100% dari total pendapatan platform.
Sebagai contoh, jika pengguna memiliki 1% token STM, dan platform menghasilkan $ 100 dalam 10 menit, kamu akan menerima 1% dari pendapatan tersebut setiap 10 menit.

Sebelum mengirimkan dividen, sistem mengumpulkan pendapatan dalam berbagai mata uang berbeda dan membeli token yang dijual di platform untuk dikirim sebagai dividen. Mekanisme seperti itu mendongkrak pertumbuhan token itu sendiri, dan juga memungkinkan kamu menyimpan token pada dompet pribadimu dan tidak melekat pada satu exchange.

Pendekatan seperti itu mengharuskan setiap pemegang token untuk mempromosikan platform, menarik pengguna baru, karena dia tertarik untuk meningkatkan penghasilannya. Ini akan secara signifikan menghemat anggaran iklan dan mempertahankan tingkat kepercayaan.


Whitelabel dan ekosistem

Dengan bantuan solusi Whitelabel, setiap perusahaan atau pengusaha akan dapat meluncurkan exchange crypto mereka sendiri, tanpa memiliki pengetahuan teknis - hanya dengan beberapa klik. Ini memecahkan masalah pengembangan jangka panjang dan merekrut staf programmer dalam jumlah besar.

Lain daripada yang lain, platform ini tidak hanya menerima fungsionalitas penuh dari Stoxum asli, tetapi juga kemampuan untuk menyesuaikan interface, menambah / mengubah fungsionalitas, dan kemungkinan legalisasi menggunakan AML / KYC.


Satu pool likuiditas dan order dalam ekosistem

Keuntungan utama bagi perusahaan yang memanfaatkan solusi Whitelabel adalah akses ke kumpulan/pool order umum. Sebagai contoh, jika ada 10 situs dalam ekosistem, maka mulai 11 - pengguna akan segera mendapatkan akses ke order yang ditempatkan di semua exchange.

Mengapa berinvestasi di Stoxum menguntungkan?

Kami percaya bahwa sistem yang mana setiap pemegang token tidak hanya tertarik untuk memperoleh pendapatan dari dividen atau meningkatkan nilai token tetapi sebenarnya memiliki kemampuan untuk secara mandiri mempengaruhi nilai koin yang saling menguntungkan.

Selain daripada itu, saya ingin menekankan bahwa keberhasilan platform Whitelabel tunggal akan meningkatkan pendapatan seluruh ekosistem.




Manfaat

Sistem Dividen

Dividen sebesar 100% dari keuntungan pada exchange dan semua produk yang ada di ekosistem platform. Ini berarti bahwa setiap pemegang token punya hak untuk menerima pendapatan dalam bentuk dividen, yang akan sebanding dengan jumlah kepemilikan, relatif terhadap emisi saat ini.

Dividen diberikan dalam bentuk token STOXUM di wallet secara real time (setiap sepuluh menit sekali). Sebelum mengirimkan dividen, sistem mengumpulkan pendapatan dalam berbagai mata uang berbeda dan membeli token yang dijual di platform untuk dikirim sebagai dividen. Mekanisme seperti itu mendongkrak pertumbuhan token itu sendiri, dan juga memungkinkan kamu menyimpan token pada dompet pribadimu dan tidak melekat pada satu exchange.



Model pemasaran berdasarkan pada dividen

Kami percaya ketika setiap pemilik token menerima dividen secara real time, maka semua orang akan tertarik untuk mempromosikan dan mengembangkan layanan, dan pemasaran dari mulut ke mulut akan berimbas bagus dan akan memangkas biaya iklan. Model pemasaran utama dapat ditemukan di Whitepaper kami.

Penyesuaian bot trading

Kami memutuskan memberi pengguna kesempatan untuk menjalankan dan mengkonfigurasi bot trading hanya dalam beberapa klik. Bot mendukung sistem pengaturan penawaran fleksibel, dan juga memiliki kemampuan untuk memasang algoritma (cut loss) stop loss / (keuntungan) take profit.

Sumber terbuka kode klien dan master nodes

Seluruh kode bisa dilihat di GitHub.com. Semua fungsi dasar akan dikembangkan oleh tim kami, tetapi ketika platform berkembang, setiap pengembang pihak ketiga dapat berkontribusi dalam fungsional proyek.

Transparansi dari semua transaksi keuangan

Setiap pemegang token memiliki hak eksklusif untuk mengakses semua statistik keuangan platform. Kami percaya bahwa perlu untuk mengungkapkan semua indikator keuangan untuk menghindari kecurigaan atau kesalahpahaman dalam sistem penghitungan dividen.



Sistem voting untuk penambahan koin

Sistem akan mempertimbangkan beberapa parameter seperti total perputaran akun dan jumlah kepemilikan token Stoxum. Pada saat yang sama, kamu dapat melihat asal dari setiap suara. Pendekatan ini akan membantu untuk menghindari kecurangan atau secara efektif mengidentifikasi mereka.

Program afiliasi dua level

Kami memberi kesempatan untuk mendapatkan hingga 50% dari pendapatan, dari penerimaan layanan untuk setiap pengguna, yang kamu bawa ke situs. Selain itu, mitra akan memiliki kesempatan untuk membuat subakun - meluncurkan program afiliasi mereka dengan deduksi terkontrol untuk jaringan-CPA.

API dan dokumentasi

Kami menyediakan dokumenentasi yang terperinci dan konfigurasi fleksibel hak akses token. Platform akan mendukung kerja protokol HTTP dan WebSocket.

White Label

Salah satu arah utama platform adalah tawaran solusi teknis cepat untuk mengatur exchange cryptocurrency-mu sendiri atau pengenalan perangkat lunak untuk bekerja dengan cryptocurrency di situsmu sendiri.

Semua proyek Whitelabel akan berlokasi di ekosistem yang sama dan memiliki basis likuiditas tunggal, yang akan memungkinkan dari hari pertama operasi untuk memberi akses kepada pengguna ke semua order aktif dalam ekosistem. Pelanggan akan diberi kesempatan untuk memvisualisasi penyesuaian interface, serta beberapa node fungsional, seperti pilihan mata uang trading yang akan disajikan pada layanan dan lainnya.

Pendapatan dasar dari solusi whitelabel adalah pengguna terdaftar pada situsmu sendiri. Pemilik Whitelabel akan dapat mendaftarkan layanannya secara mandiri dan mendapatkan semua lisensi yang diperlukan untuk melakukan kegiatan yang sah - untuk tujuan ini, sistem verifikasi kebijakan AML / KYC tersedia dalam fungsional.




Perancangan





Kami memiliki proposal yang menarik, yang pertama-tama akan menarik bagi para pembuat pasar (maker): diskon operasional trading dalam platform menggunakan sistem maker / taker tergantung pada volume investasi:

5,000 STM+ 3%
7,000 STM+  5%
12,000 STM+ 10%
18,000 STM+ 15%
25,000 STM+ 20%
40,000 STM+ 30%
80,000STM+ 50%






FAQ

Kenapa kami tidak mengungkapkan nama kami?
Ide utama dari proyek ini adalah menciptakan produk yang dikelola oleh masyarakat. Dalam hal ini, produk itu sendiri milik masyarakat, dan bukan untuk beberapa individu.



Mata uang apa yang diterima untuk membeli STM?
Kami akan menerima BTC, ETH, LTC, BCH dan XRP


Bagaimana kamu sebenarnya akan membeli dan meminta token jika kamu tidak menggunakan smart contract?
Masing-masing peserta akan memiliki akses ke akun pribadinya, di mana ia akan memiliki dompet pribadi (BTC, ETH, LTC, BCH, dan XRP) untuk mentransfer dana. Di sini kamu dapat melihat jumlah saldo STM, serta menarik dana ke dompet lain.




Tim proyek akan dengan senang hati menjawab semua pertanyaanmu







Saat ini website tersedia dalam 5 bahasa:

Rusia: https://stoxum.org/ru/

Inggris: https://stoxum.org/en/

Italia: https://stoxum.org/it/

China: https://stoxum.org/cn/

Korea: https://stoxum.org/kr/









THREAD YANG TERSEDIA (Bahasa lain):





Thread ANN Asli: Di sini



Saya hanya berperan sebagai penerjemah thread ANN dan thread Bounti dari STOXUM dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

14  Local / Altcoins (Bahasa Indonesia) / 💰 [BOUNTY] [AIRDROP] MPCX - Manajemen Kekayaan Digital [ resmi ditutup ] on: May 05, 2018, 11:19:39 PM
🚀

                                 


Bounti tahap kedua di sini >> https://bitcointalk.org/index.php?topic=5025510


Program Bounty sekarang resmi Ditutup

Pengumuman


Finalisasi perhitungan stake telah dilakukan jika teman-teman yang gabung di di Bounti menemukan kesalahan dalam perhitung stake, silakan PM manager.


*****Peserta diberi waktu 10 hari untuk mengoreksi. Silakan PM manager jika ada masalah atau koreksi

Batas ahir untuk koreksi tersebut adalah tanggal 14 September , pukul 11 malam waktu forum

     WHITEPAPER

Selamat datang di MPCX, kami memperkenalkan katalis untuk revolusi Manajemen Kekayaan Crypto Baru, membantu membangun komunitas kami dan menerima bagian dalam Manajemen Kekayaan Aset Digital di masa depan. Airdrop terbuka untuk anggota komunitas MPCX, kami ingin memberi imbalan kepada mereka yang pertama kali bergabung, Terima kasih.

MASTER CHECKLIST

🥁🥁🥁Perhatian🥁🥁🥁

⚡️MPCX telah mencapai hardcap preICO sebesar 1000 ETH⚡️
Iurii Riabykin dan Phil Millo, pendiri MPCX secara resmi mengkonfirmasi kesuksesan Pre ICO MPCX. Pre ICO ditutup, Hardcap Pre ICO sebesar 1 000 ETH telah tercapai!🔥


✌️Kami telah meluncurkan website baru kami!


🚀Dasbord klien MPCX akan dirilis akhir Agustus.


MPCX telah merilis token XDMC berbasis ERC-20. Kode token tersedia di GitHub dan Etherscan.


Link Github: https://github.com/MPCXPlatformLTD

Alamat Kontrak : https://etherscan.io/address/0xcd22b66827bd35c4a6375a960ef6c5d003f98cc1



---------------------------------------------------------------------------------------------


---------------------------------------------------------------------------------------------

ANN - Halaman Pengumuman Penjualan Token
---------------------------------------------------------------------------------------------

KAMPANYE BOUNTI MPCX berahir pada 3 September

---------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------------

Total Token yang dialokasikan hingga 16,000,000 XDMC. Ini berarti nilai total dari Pool Bounti adalah sekitar 2,244,600 USD.


---------------------------------------------------------------------------------------------
1ETH =4277 XDMC
---------------------------------------------------------------------------------------------


1. MPCX mengalokasikan 4% dari seluruh penawaran Token XDMC untuk Kampanye Bounti
2. Jumlah total Token XDMC yang dialokasikan untuk kampanye Bounty adalah 40000000.
3. Ini setara dengan 9 352 ETH berdasarkan nilai XDMC.
4. Total token yang dialokasikan pada Bounti Pre ICO dan ICO Tahap 1 adalah 16000000, yang setara dengan 3741 ETH
5. Jumlah peserta Kampanye Bounti MPCX terbatas.
6. Kami berharap harga apresiasi XDMC dan harga Token XDMC yang lebih tinggi pada tahapan ICO berikutnya dalam hal proyek dan pengembangan bisnis.

----------------------------------------------------------------------------------------------------------------------------------------------------------------




Setiap periode akan berakhir hari Minggu @ 11: 00 malam waktu forum

------------------------------------------------------------------------------------------------------

Minggu 1 :- 1 Mei - 6 Mei  -- Berahir
Minggu 2 :- 7 Mei - 13 Mei  -- Berahir
Minggu 3 :- 14 Mei - 20 Mei  -- Berahir
Minggu 4 :- 21 Mei - 27 Mei  -- Berahir
Minggu 5 :- 28 Mei - 3 Juni  -- Berahir
Minggu 6 :- 4 Juni - 10 Juni  -- Berahir
Minggu 7 :- 11 Juni - 17 Juni  -- Berahir
Minggu 8 :- 18 Juni - 24 Juni  -- Berahir
Minggu 9 :- 25 Juni - 1 Juli  -- Berahir
Minggu 10 :- 2 Juli - 8 Juli  -- Berahir
Minggu 11 :- 9 Juli - 15 Juli  -- Berahir
Minggu 12 :- 16 Juli - 22 Juli  -- Berahir
Minggu 13 :- 23 Juli - 29 Juli  -- Berahir
Minggu 14 :- 30 Juli - 5 Agustus  -- Berahir
Minggu 15 :- 6 Agustus - 12 Agustus  -- Berahir
Minggu 16 :- 13 Agustus - 19 Agustus  -- Berahir
Minggu 17 :- 20 Agustus - 26 Agustus  -- Berahir
Minggu 18 :- 27 Agustus - 2 September  -- Berahir

------------------------------------------------------------------------------------------------------



1. Peserta Bounti MPCX akan mendapat imbalan yang dihitung setiap minggu.                                 
2. Token XDMC akan didistribusikan dalam 5 hari setelah kampanye bounti berahir.                                 
3. Setelah kampanye selesai, imbalan akan dihitung menggunakan rumus berikut:                                 
4. Imbalan bounti token XDMC untuk stake peserta = ((Jumlah total Token XDMC untuk tahap ICO saat ini tidak termasuk Node 1 dan Node 2 *
% alokasi untuk kampanye khusus) / Jumlah total penghargaan peserta dalam kampanye) * Jumlah total penghargaan dari tiap peserta                                 
Misalnya. untuk kampanye Signature dengan alokasi 15% (16 000 000 * 0,15 / 1000) * 200 = 480 000 token XDMC                              
5. Stake yang diperoleh peserta dalam kampanye akan dialokasikan tiap minggu pada hari Senin.                                 
6. Harap semua pertanyaan tentang bounti ditanyakan di sini: BOUNTY QUERIES                                 
7. Dilarang untuk mengobrol dan mengajukan pertanyaan terkait bounti di sini: TELEGRAM COMMUNITY                                 
8. Kami memiliki hak untuk menghapus setiap peserta yang menunjukkan perilaku agresif terhadap manajer bounti.
9. Semua peserta bounti akan menerima Token XDMC berbasis Ethereum, yang akan tersedia setelah Pre ICO.


SETIAP PESERTA HARUS BERGABUNG DALAM 2 GROUP TELEGRAM INI https://t.me/joinchat/HKzpNw7GALGgezy0GrTT9w dan  TELEGRAM OFFICIAL GROUP



Airdrop:

Mari Berkenalan, jika kamu tertarik dengan MPCX dan masa depan Manajemen Kekayaan Crypto Digital, Bergabunglah dengan kami hari ini, Dapatkan 50 Token XDMCmu.                            
1. Follow kami di twitter: https://twitter.com/MPCXPlatform                              
2. Like & Retweet minimal satu Tweet menggunakan hashtag berikut: #MPCXP #Cryptocurrency#blockchain #token#crypto #Airdrop                              
3. Bergabunglah dengan Telegram kami: https://t.me/MPCXPlatfromCommunity
4. Follow kami di Facebook https://www.facebook.com/MPCXPlatformdan sukai halaman kami serta bagikan minimal 1 posting dengan hashtag berikut: #MPCXP #Cryptocurrency#blockchain #token#crypto #Airdrop                              
Dapatkan 50 token XDMC dengan bergabung hari ini.                              
Peserta harus menyimpan semua pos / pekerjaanya hingga akhir ICO.                              
Total pendaftaran yang diterima 32000.         

Cara pendaftaran https://goo.gl/forms/8J2HzqIJ449jXFwY2

Silakan tanyakan semua yang berkaitan dengan bounti di sini: https://t.me/joinchat/HKzpNw7GALGgezy0GrTT9w         
Dilarang untuk mengobrol dan mengajukan pertanyaan terkait bounti di sini: https://t.me/MPCXPlatfromCommunity



Referral:                           
                           
Program Friend2Friend, telah menyelesaikan Airdrop namun ingin mendapatkan LAGI?                           
Kami memberimu kesempatan, dengan mengarahkan teman-temanmu dan menjawab pertanyaan sederhana tentang MPCX. Jawaban atas semua pertanyaan dapat ditemukan di website mpcx.co.      

                     
                           
Segera hadir               

      



PERATURAN KAMPANYE FACEBOOK



Jumlah Follower                           Stake/Aksi per Minggu
101-500                                                 100
501-1000                                               150
1001-2000                                              200
2001-3000                                              250
3001-∞                                                  300
Minimal Interval antara postingmu adalah     1 Hari


Ketentuan kampanye Facebook:   
               
1. Memiliki minimal 100 teman dan buatlah pengaturan privasi halamanmu menjadi terbuka                                 
2. Untuk memenuhi syarat kamu harus memfollow dan menyukai halaman resmi MPCX di Facebook: https://fb.me/MPCXPlatform,
3. Kamu harus menyukai dan membagikan minimal 5 posting per minggu dari halaman Facebook resmi kami dan harus dilakukan
lebih dari satu hari dalam seminggu.
4. Supaya memenuhi syarat setiap peserta harus membuat min 2 pos sendiri per minggu
5. Stake akan dialokasikan jika kamu memenuhi syarat. Postingmu harus sesuai dan berkualitas serta diperiksa oleh manajer bounti.                  
6. Pendaftaran multi akun tidak diizinkan, semua akun terkait tidak akan diperiksa dan akan dihapus.                  
7. Akun Facebook harus original; palsu, mati, tidak aktif dan akun bot tidak akan diterima dan tidak memenuhi syarat untuk pembayaran jika ditemukan pada saat kampanye berlangsung.                  
                                 
Format untuk memposting pekerjaanmu
Code:
Week #1
Facebook

Shares + Likes
1.
2.
3.
4.
5.

Own Post
1.
2.



Cara pendaftaran :- https://goo.gl/forms/JZvkmGGnYa0tGgIY2

Link Spreadsheet (Facebook) :- https://docs.google.com/spreadsheets/d/18DiWz6p2BBBXbrf_OPbVYMQaXXqUjKyycpuCicuDFmQ/edit?usp=sharing
            




PERATURAN KAMPANYE TWITTER

Jumlah Follower                  Stake/Aksi
200-750                                             100
751-1500                                           150
1501-4000                                         200
4001-10000                                       250
10000+                                             300

Minimal Interval antara tweetmu adalah 10 jam


Ketentuan kampanye Twitter:                     
1. Memiliki minimal 100 teman dan buatlah pengaturan privasi akunmu menjadi terbuka.         
2. Follow Twitter resmi MPCX : https://twitter.com/MPCXPlatform   .                  
3. Untuk memenuhi syarat kamu harus memfollow dan menyukai halaman resmi MPCX di https://twitter.com/MPCXPlatform                   
4. Minimal dari 5 retweet harus dilakukan setiap minggu supaya memenuhi syarat untuk pembayaran & retweet harus tersebar lebih dari satu hari dalam perminggu.   
5. Kamu harus membuat tweet minimal 2 tweet asli tentang MPCX dan menggunakan hashtag #MPCXP #Cryptocurrency#blockchain #token#crypto #Airdrop            
6. MPCX berhak mengubah ketentuan atau menerapkan ketentuan dan aturan baru atau melakukan perubahan yang wajar (termasuk struktur dan jumlah pembayaran).                     
7. Retweet harus di-retweet dari halaman resmi MPCX: https://twitter.com/MPCXPlatform                     
8. Peserta harus menyimpan semua posting / pekerjaanya hingga akhir Pre ICO dan ICO Tahap Pertama.                  
  
Format untuk memposting pekerjaanmu
Code:
Week #1
Twitter

Retweets
1.
2.
3.
4.
5.

Tweets
1.
2.


Cara pendaftaraan :- https://goo.gl/forms/ESI4Op6tudkCClU53

Link Spreadsheet (Twitter) :- https://docs.google.com/spreadsheets/d/18DiWz6p2BBBXbrf_OPbVYMQaXXqUjKyycpuCicuDFmQ/edit?usp=sharing

         



PERATURAN KAMPANYE TERJEMAHAN

Terjemahan dari thread ANN : 350 stake (deadline - 7 hari).
Terjemahan dari thread Bounti : 500 stake (deadline - 7 hari).
Terjemahan dari whitepaper: 750 stake (deadline - 7 hari).            
                     
                     
1. Isi formulir kampanye terjemahan kami
2. Setelah diterima dan menyelesaikan terjemahan, silahkan post di thread ini dengan link website atau whitepaper yang diterjemahkan.   
                                       
3. Kami melarang menggunakan Google Translate atau layanan lainnya;                     
4. Peserta yang menggunakan Google Translate atau layanan lain akan langsung didiskualifikasi;                     
5. Peserta hanya boleh mendaftar satu bahasa terjemahan;                     
6. Pendaftaran untuk terjemahan dalam beberapa bahasa tidak akan diizinkan.                     
7. Jangan mulai menerjemahkan sebelum kami menerimamu                     
8. Kandidat yang memiliki akun Bitcointalk degan riwayat negatif tidak memenuhi syarat.                     
9. Tidak merusak makna teks dan tulisan, tidak ada ringkasan informasi atau perubahan struktur atau konsep lainnya.                                    
Jika kamu memesan pekerjaan tetapi gagal menyelesaikannya, kami akan membatalkan reservasimu dan meneruskan ke peserta bounti lainnya.                     
List terjemahan / bahasa yang disediakan akan diperbarui pada pos pertama di thread ini.                     
10. Tim MPCX berhak mengubah ketentuan atau menerapkan yang baru kapan saja atas kebijakannya sendiri.                     
11. Semua terjemahan akan diperiksa oleh pembaca profesional.                     
12. MPCX berhak untuk menghapus kamu dari kampanye jika menurut kami terjemahanmu tidak memuaskan.   


File whitepaper yang dapat diedit :-    https://drive.google.com/file/d/1uWZrFNRNCJz9B30o0qndt-v3ZhEPpphH/view?usp=sharing


Cara pendaftaran :- https://goo.gl/forms/wawWIJYzQUXr9z2h1

Link Spreadsheet (Terjemahan) :- https://docs.google.com/spreadsheets/d/18DiWz6p2BBBXbrf_OPbVYMQaXXqUjKyycpuCicuDFmQ/edit?usp=sharing            
                     



PERATURAN BOUNTI TELEGRAM


1. Bergabunglah dalam telegram kami dan jadilah anggota yang aktif: https://t.me/MPCXPlatfromCommunity (JANGAN MENGIRIM PERTANYAAN TERKAIT BOUNTI DISANA)         
2. Kamu akan menerima 50 stake setiap minggu untuk 4-5 pos, postmu setidaknya 100 karakter.         
3. MPCX berhak untuk mengubah ketentuan atau menerapkan ketentuan dan aturan baru atau melakukan perubahan yang wajar (termasuk struktur dan jumlah pembayaran).         
4. Kamu harus memperbarui nama pengguna Telegrammu ke " Namamu | MPCX.co" "
5. Kamu harus mengganti foto profilmu dengan yang ada DI SINI

Cara pendaftaran :- https://goo.gl/forms/vmI2qehWhxiOnZGe2

Link Spreadsheet (Telegram) :- https://docs.google.com/spreadsheets/d/18DiWz6p2BBBXbrf_OPbVYMQaXXqUjKyycpuCicuDFmQ/edit?usp=sharing

   


PERATURAN KAMPANYE ARTIKEL/BLOG/VIDEO

MPCX akan memberi imbalan kepada Penulis dan Blogger berpengalaman yang menulis review atau artikel berkualitas atau membuat video tentang Platform MPCX, Pre ICO, ICO, Instruksi tentang Investasi pada Token XDMC di Blog, Website, Forum, dan Sumber lainnya.


Petunjuk penulisan blog / artikel / review:
Artikel / review / blog pos harus memiliki minimal 500 kata.
Teksmu harus original. Mengcopi dan mencuri konten lainnya akan di diskualifikasi
Audien untuk postingan Artikel harus mengenai crypto atau cocok digunakan untuk MPCX.co atau promosikan PENJUALAN TOKEN ke audiens yang sesuai.
Website harus memiliki audien asli. Website baru tidak akan diterima.
Medium, Steemit dan Blog Gratis lainnya diperbolehkan tetapi satu orang hanya dapat menulis 1 Artikel di salah satu ini (Kamu harus memilih mana yang kamu gunakan).
1 artikel diizinkan di blog dan website premium dengan domain .com, .net. .org atau domain lainnya yang memiliki SEO yang bagus.
Artikel / review / blog pos harus mengandung minimal 1 link wesbite MPCX.co (gunakan link Tracking ini saja)

Petunjuk video:

Deskripsikan MPCX.co dan fitur-fiturnya
Video harus dalam resolusi yang bagus
Video harus minimal 2 menit.
Kamu dapat mengunggahnya ke Youtube, Dailymotion atau yang lainnya.
Kamu akan menerima imbalan berdasarkan kualitas dan jumlah audien Video tsb.




Imbalan
Kwalitas & audien Normal: 20 stake
Kwalitas & audien Menengah: 50 stake
Kwalitas & audien Tinggi: 100 stake

Cara pendaftaran :- https://goo.gl/forms/MGOLjGoEyFkSvqqq1

Link Spreadsheet (Blog/Video) :- https://docs.google.com/spreadsheets/d/18DiWz6p2BBBXbrf_OPbVYMQaXXqUjKyycpuCicuDFmQ/edit?usp=sharing




PERATURAN KAMPANYE SIGNATURE


1. Minimal 10 postingan harus dilakukan setiap minggu.
2. Postingan harus minimal 100 karakter.
3. Postingan harus konstruktif dan tidak menyatakan kembali apa yang dikatakan orang lain.
4. Akun yang memiliki reputasi negatif tidak diizinkan untuk berpartisipasi.
5. Jika kamu menerima reputasi negatif selama kampanye, kamu akan dikeluarkan.
6. Semua peserta mulai Full Member harus memasang avatar kami
7. Spam benar benar tidak dapat ditoleransi.
8. Postingan di thread bounti, local boards, off-topic, Games and Rounds, Micro Earnings and Politics and Society tidak akan dihitung
9. Iklan apa pun yang ada di Signaturemu akan membuatmu dikeluarkan dari kampanye.   
   
Ketentuan Kampanye Signature:
Jr. Member:              10 stake per minggu
Member:                  20 stake per minggu   
Full Member:            40 stake per minggu   
Sr. Member:             50 stake per minggu   
Hero Member:          70 stake per minggu   
Legendary Member:  90 stake per minggu   
   

Cara pendaftaran :- https://goo.gl/forms/xfrlTv3Wjq1R83qy1

Link Spreadsheet (signature) Embarrassed https://docs.google.com/spreadsheets/d/18DiWz6p2BBBXbrf_OPbVYMQaXXqUjKyycpuCicuDFmQ/edit?usp=sharing


Desain Signature


JR MEMBER


Code:
[center][url=https://mpcx.co/]↢↢↢↢│   MPCX   │↣↣↣↣
│ Digital Wealth Management Platform │
- PRE-ICO STARTS NOW -[/url][/center]


MEMBER



Code:
[center][url=https://mpcx.co/][font=arial]│MPCX - Digital Wealth Management Platform│[/font][/url]
[font=rockwell][url=https://drive.google.com/file/d/1jZZA-EtZz0O02sOG8w-vcZdX93GtJXJ-/view]│WHITEPAPER│[/url]↢↢↢↢ [url=https://fb.me/MPCXPlatform]FACEBOOK[/url]┊[url=https://twitter.com/MPCXPlatform]TWITTER[/url]┊[url=https://t.me/joinchat/HKzpNxMFbX0HYo9-BScO6A]TELEGRAM[/url]┊[url=https://medium.com/@mpcxplatform]MEDIUM[/url]┊[url=https://www.youtube.com/channel/UCJrgPLexmtA4hA6ux5GTpQQ/featured?view_as=subscriber]YOUTUBE[/url] ↣↣↣↣[url=https://bitcointalk.org/index.php?topic=3362739.0]│BOUNTY│[/url][/font]
--- [url=https://mpcx.co/#rec50250191]PRE-ICO STARTS NOW[/url] ---[/center]


FULL MEMBER



Code:
[center][url=https://mpcx.co/][font=arial]│[color=#6a008c][b]MPCX[/b][/color] - [color=#ff00ff][i]Digit[/i][/color][color=#e907e9][i]al Wea[/i][/color][color=#d40dd4][i]lth Man[/i][/color][color=#b90eb9][i]agemen[/i][/color][color=#a411a4][i]t Platform[/i][/color]│[/font][/url]
[font=rockwell][url=https://drive.google.com/file/d/1jZZA-EtZz0O02sOG8w-vcZdX93GtJXJ-/view][color=#6a008c]│[b]WHITEPAPER[/b]│[/color][/url]↢↢↢↢ [url=https://fb.me/MPCXPlatform][color=#ff00ff][b]FACEBOOK[/b][/color][/url]┊[url=https://twitter.com/MPCXPlatform][color=#ff00ff][b]TWITTER[/b][/color][/url]┊[url=https://t.me/joinchat/HKzpNxMFbX0HYo9-BScO6A][color=#ff00ff][b]TELEGRAM[/b][/color][/url]┊[url=https://medium.com/@mpcxplatform][color=#ff00ff][b]MEDIUM[/b][/color][/url]┊[url=https://www.youtube.com/channel/UCJrgPLexmtA4hA6ux5GTpQQ/featured?view_as=subscriber][color=#ff00ff][b]YOUTUBE[/b][/color][/url] ↣↣↣↣[url=https://bitcointalk.org/index.php?topic=3362739.0][color=#6a008c]│[b]BOUNTY[/b]│[/color][/url][/font]
--- [url=https://mpcx.co/#rec50250191][color=#6a008c][b]PRE-ICO STARTS NOW[/b][/color][/url] ---[/center]



SR MEMBER

        ██     ██
   ▄▄       ██   ██   ▄▄
   ▀▀ ▀▀ ▄   ▀▀  ▄▄   ▀▀
     ▄▄   ▀█ ▀▀ ▄  ██
▄▄ █ ▀▀ ██  ▄▄▄▄ ▀  ██   ▄▄
▀▀    ▄▄  ██▀  ▀██ ▀▀  ▄▄▀▀
  ▄▄█▀▀  ██      ██ ▄▄█▀▀
▄▄▀▀   █▀ ██▄  ▄██ ▀▀    ▄▄
▀▀   ██  ▄  ▀▀▀▀ ▀█ ▄▄ █▀▀▀
    █▄  ▄  ▀█  ▀█▄
   ▄▄▄  ▀▀  ▄█▄  ▀▀▄▄ ▄▄
    ▀   ▀▀    ▄▄      ▀▀
         ██     ██
MPCX
███
███
███
███
███
███
███
███
███
███
███
DIGITAL WEALTH MANAGEMENT PLATFORM
FACEBOOKTWITTERTELEGRAMMEDIUMYOUTUBE

███
███
███
███
███
███
███
███
███
███
███

▄██████████████████▄
███       ▀███████
███       █████████
███       █████████
███       █████████
███              ██
███   ▄▄▄▄▄▄▄▄   ███
███   ▄▄▄▄▄▄▄▄   ███
███              ███
███▄▄▄▄▄▄▄▄▄▄▄▄▄▄███
██████████████████▀

▄██████████████████▄
███████████▀ ███████
█████████▀   ███████
███████▀     ██▀ ███
███ ▀▀       █▄▄████
███          █▀▀▀▀██
███ ▄▄       ███████
██████▄     █▄ ▀███
█████████▄   ███▄███
███████████▄ ███████
▀██████████████████▀



Code:
[center][table][tr]
[td][url=https://mpcx.co/][tt][size=2pt][color=#6a168a]         ██     ██
   ▄▄       [color=#20416e]██   ██[/color]   ▄▄
   ▀▀ [color=#20416e]▀▀ ▄   ▀▀  ▄▄[/color]   ▀▀
     ▄▄   [color=#20416e]▀[color=#005f5d]▀█ ▀▀ ▄[/color]▀[/color]  ██
▄▄ [color=#20416e]█ ▀▀ [color=#005f5d]██  ▄▄▄▄ ▀[/color]  ██[/color]   ▄▄
▀▀    [color=#005f5d]▄▄  ██▀  ▀██ ▀[/color]▀  ▄▄▀▀
  [color=#20416e]▄▄█▀▀  [color=#005f5d]██      ██[/color] ▄▄█▀▀[/color]
▄▄[color=#20416e]▀▀   [color=#005f5d]█▀ ██▄  ▄██ ▀▀[/color][/color]    ▄▄
▀▀   [color=#20416e]██  [color=#005f5d]▄  ▀▀▀▀ ▀█[/color] ▄▄ █▀[/color]▀▀
    [color=#20416e]█▄  ▄  [color=#005f5d]▀█  ▀[/color]█▄[/color]
   ▄▄▄  [color=#20416e]▀▀  ▄█▄  ▀▀▄▄[/color] ▄▄
    ▀   [color=#20416e]▀▀    ▄▄[/color]      ▀▀
         ██     ██[/color][/size][/tt][/url][/td]
[td][url=https://mpcx.co/][font=arial][size=22pt][color=#6a008c][b]MPCX[/b][/color][/size][/font][/url][/td]
[td][tt][size=2pt][color=#6a008c]
███
███
███
███
███
███
███
███
███
███
███[/color][/size][/tt][/td]
[td][center][font=rockwell][size=13pt][color=#ff00ff][b]DIGIT[/b][/color][color=#e907e9][b]AL WEA[/b][/color][color=#d40dd4][b]LTH MAN[/b][/color][color=#b90eb9][b]AGEMEN[/b][/color][color=#a411a4][b]T PLATFORM[/b][/color][/size]
[size=10pt][url=https://fb.me/MPCXPlatform][color=#6a008c][b]FACEBOOK[/b][/color][/url] ┇ [url=https://twitter.com/MPCXPlatform][color=#6a008c][b]TWITTER[/b][/color][/url] ┇ [url=https://t.me/joinchat/HKzpNxMFbX0HYo9-BScO6A][color=#6a008c][b]TELEGRAM[/b][/color][/url] ┇ [url=https://medium.com/@mpcxplatform][color=#6a008c][b]MEDIUM[/b][/color][/url] ┇ [url=https://www.youtube.com/channel/UCJrgPLexmtA4hA6ux5GTpQQ/featured?view_as=subscriber][color=#6a008c][b]YOUTUBE[/b][/color][/url][/size][/font][/center][/td]
[td][tt][size=2pt][color=#6a008c]
███
███
███
███
███
███
███
███
███
███
███[/color][/size][/tt][/td]
[td][url=https://drive.google.com/file/d/1jZZA-EtZz0O02sOG8w-vcZdX93GtJXJ-/view][tt][size=2pt][color=#6a008c]
▄██████████████████▄
███       [color=#3e3c3c]▄[/color][color=#b3a9a9]█[/color]▀███████
███       [color=#3e3c3c]█[/color][color=#b3a9a9]████[/color]█████
███       [color=#3e3c3c]█[/color][color=#b3a9a9]██████[/color]███
███       [color=#3e3c3c]███████[/color][color=#19191a]█[/color]██
███              [color=#19191a]██[/color]█
███   ▄▄▄▄▄▄▄▄   [color=#19191a]███[/color]
███   ▄▄▄▄▄▄▄▄   [color=#19191a]███[/color]
███              [color=#19191a]███[/color]
██[color=#19191a]█▄▄▄▄▄▄▄▄▄▄▄▄▄▄███[/color]
▀[color=#19191a]██████████████████▀[/color][/color][/size][/tt][/url][/td]
[td][url=https://bitcointalk.org/index.php?topic=3362739.0][tt][size=2pt][color=#ff00ff]
▄██████████████████▄
███████████▀ ███████
█████████▀   ███████
███████▀     ██▀ ███
███ ▀▀       █▄▄████
███          █▀▀▀▀██
██[color=#751810]█ ▄▄       █[/color]██████
█[color=#751810]██████▄     █▄[/color] ▀███
[color=#751810]█████████▄   ███[/color]▄███
[color=#751810]███████████▄ ████[/color]███
[color=#751810]▀█████████████████[/color]█▀[/color][/size][/tt][/url][/td]
[td][center][url=https://mpcx.co/#rec50250191][font=arial][color=#6a008c][b][size=14pt]PRE-ICO[/size]
[size=8pt]STARTS NOW[/size][/color][/font][/url][/center][/td]
[/tr][/table][/center]



HERO MEMBER & LEGENDARY MEMBER

        ██     ██
   ▄▄       ██   ██   ▄▄
   ▀▀ ▀▀ ▄   ▀▀  ▄▄   ▀▀
     ▄▄   ▀█ ▀▀ ▄  ██
▄▄ █ ▀▀ ██  ▄▄▄▄ ▀  ██   ▄▄
▀▀    ▄▄  ██▀  ▀██ ▀▀  ▄▄▀▀
  ▄▄█▀▀  ██      ██ ▄▄█▀▀
▄▄▀▀   █▀ ██▄  ▄██ ▀▀    ▄▄
▀▀   ██  ▄  ▀▀▀▀ ▀█ ▄▄ █▀▀▀
    █▄  ▄  ▀█  ▀█▄
   ▄▄▄  ▀▀  ▄█▄  ▀▀▄▄ ▄▄
    ▀   ▀▀    ▄▄      ▀▀
         ██     ██
MPCX
███
███
███
███
███
███
███
███
███
███
███
..DIGITAL WEALTH MANAGEMENT PLATFORM..
FACEBOOKTWITTERTELEGRAMMEDIUMYOUTUBE

███
███
███
███
███
███
███
███
███
███
███

▄██████████████████▄
███       ▀███████
███       █████████
███       █████████
███       █████████
███              ██
███   ▄▄▄▄▄▄▄▄   ███
███   ▄▄▄▄▄▄▄▄   ███
███              ███
███▄▄▄▄▄▄▄▄▄▄▄▄▄▄███
██████████████████▀

▄██████████████████▄
███████████▀ ███████
█████████▀   ███████
███████▀     ██▀ ███
███ ▀▀       █▄▄████
███          █▀▀▀▀██
███ ▄▄       ███████
██████▄     █▄ ▀███
█████████▄   ███▄███
███████████▄ ███████
▀██████████████████▀



Code:
[center][table][tr]
[td][url=https://mpcx.co/][tt][size=2pt][color=#6a168a]         ██     ██
   ▄▄       [color=#20416e]██   ██[/color]   ▄▄
   ▀▀ [color=#20416e]▀▀ ▄   ▀▀  ▄▄[/color]   ▀▀
     ▄▄   [color=#20416e]▀[color=#005f5d]▀█ ▀▀ ▄[/color]▀[/color]  ██
▄▄ [color=#20416e]█ ▀▀ [color=#005f5d]██  ▄▄▄▄ ▀[/color]  ██[/color]   ▄▄
▀▀    [color=#005f5d]▄▄  ██▀  ▀██ ▀[/color]▀  ▄▄▀▀
  [color=#20416e]▄▄█▀▀  [color=#005f5d]██      ██[/color] ▄▄█▀▀[/color]
▄▄[color=#20416e]▀▀   [color=#005f5d]█▀ ██▄  ▄██ ▀▀[/color][/color]    ▄▄
▀▀   [color=#20416e]██  [color=#005f5d]▄  ▀▀▀▀ ▀█[/color] ▄▄ █▀[/color]▀▀
    [color=#20416e]█▄  ▄  [color=#005f5d]▀█  ▀[/color]█▄[/color]
   ▄▄▄  [color=#20416e]▀▀  ▄█▄  ▀▀▄▄[/color] ▄▄
    ▀   [color=#20416e]▀▀    ▄▄[/color]      ▀▀
         ██     ██[/color][/size][/tt][/url][/td]
[td][url=https://mpcx.co/][font=arial][size=22pt][color=#6a008c][b]MPCX[/b][/color][/size][/font][/url][/td]
[td][tt][size=2pt][color=#6a008c]
███
███
███
███
███
███
███
███
███
███
███[/color][/size][/tt][/td]
[td][center][font=rockwell][size=13pt][glow=#ff00ff,2,300][color=#ff00ff]..[/color][color=white][b]DIGIT[/b][/color][/glow][glow=#e907e9,2,300][color=white][b]AL WEA[/b][/color][/glow][glow=#d40dd4,2,300][color=white][b]LTH MAN[/b][/color][/glow][glow=#b90eb9,2,300][color=white][b]AGEMEN[/b][/color][/glow][glow=#a411a4,2,300][color=white][b]T PLATFORM[/b][/color][color=#a411a4]..[/color][/glow][/size]
[size=10pt][url=https://fb.me/MPCXPlatform][color=#6a008c][b]FACEBOOK[/b][/color][/url] ┇ [url=https://twitter.com/MPCXPlatform][color=#6a008c][b]TWITTER[/b][/color][/url] ┇ [url=https://t.me/joinchat/HKzpNxMFbX0HYo9-BScO6A][color=#6a008c][b]TELEGRAM[/b][/color][/url] ┇ [url=https://medium.com/@mpcxplatform][color=#6a008c][b]MEDIUM[/b][/color][/url] ┇ [url=https://www.youtube.com/channel/UCJrgPLexmtA4hA6ux5GTpQQ/featured?view_as=subscriber][color=#6a008c][b]YOUTUBE[/b][/color][/url][/size][/font][/center][/td]
[td][tt][size=2pt][color=#6a008c]
███
███
███
███
███
███
███
███
███
███
███[/color][/size][/tt][/td]
[td][url=https://drive.google.com/file/d/1jZZA-EtZz0O02sOG8w-vcZdX93GtJXJ-/view][tt][size=2pt][color=#6a008c]
▄██████████████████▄
███       [color=#3e3c3c]▄[/color][color=#b3a9a9]█[/color]▀███████
███       [color=#3e3c3c]█[/color][color=#b3a9a9]████[/color]█████
███       [color=#3e3c3c]█[/color][color=#b3a9a9]██████[/color]███
███       [color=#3e3c3c]███████[/color][color=#19191a]█[/color]██
███              [color=#19191a]██[/color]█
███   ▄▄▄▄▄▄▄▄   [color=#19191a]███[/color]
███   ▄▄▄▄▄▄▄▄   [color=#19191a]███[/color]
███              [color=#19191a]███[/color]
██[color=#19191a]█▄▄▄▄▄▄▄▄▄▄▄▄▄▄███[/color]
▀[color=#19191a]██████████████████▀[/color][/color][/size][/tt][/url][/td]
[td][url=https://bitcointalk.org/index.php?topic=3362739.0][tt][size=2pt][color=#ff00ff]
▄██████████████████▄
███████████▀ ███████
█████████▀   ███████
███████▀     ██▀ ███
███ ▀▀       █▄▄████
███          █▀▀▀▀██
██[color=#751810]█ ▄▄       █[/color]██████
█[color=#751810]██████▄     █▄[/color] ▀███
[color=#751810]█████████▄   ███[/color]▄███
[color=#751810]███████████▄ ████[/color]███
[color=#751810]▀█████████████████[/color]█▀[/color][/size][/tt][/url][/td]
[td][center][url=https://mpcx.co/#rec50250191][font=arial][color=#6a008c][b][size=14pt]PRE-ICO[/size]
[size=8pt]STARTS NOW[/size][/color][/font][/url][/center][/td]
[/tr][/table][/center]


PENTING:
Pendiri dan manajer kampanye berhak, mengubah aturan, menambahkan aturan, menolak kamu dari kampanye.
 
 
 *** Setiap masalah atau pertanyaan terkait dengan bounti, kamu dapat bertanya kepada saya di sini https://t.me/joinchat/HKzpNw7GALGgezy0GrTT9w    atau posting masalahmu di sini sehingga saya bisa menyelesaikannya

** Kamu dapat bergabung dalam chanel Bounti saya untuk update terbaru tentang bounti yang sedang berlangsung dan Bounti Baru https://t.me/newsilikebounty
15  Local / Altcoins (Bahasa Indonesia) / [ANN] [PRE - ICO] Platform MPCX - Masa Depan Manajemen Kekayaan Crypto Digital! on: May 05, 2018, 07:31:23 PM





Produk unik MPCX dirancang untuk klien kami meliputi Indeks Cyrpto yang Investabel dan Mandat Investasi Cerdas Digital.



-------------------------------------------------------------------------------------------------------------------------------


BOUNTI  -- https://bitcointalk.org/index.php?topic=3465606.0

AirDrop  -- https://bitcointalk.org/index.php?topic=3465606


--------------------------------------------------------------------------------------------------------------------------------

🥁🥁🥁Perhatian🥁🥁🥁

⚡️MPCX telah mencapai hardcap preICO sebesar 1000 ETH⚡️
Iurii Riabykin dan Phil Millo, pendiri MPCX secara resmi mengkonfirmasi kesuksesan Pre ICO MPCX. Pre ICO ditutup, Hardcap Pre ICO sebesar 1 000 ETH telah tercapai!🔥


✌️Kami telah meluncurkan website baru kami!


🚀Dasbord klien MPCX akan dirilis akhir Agustus.


MPCX telah merilis token XDMC berbasis ERC-20. Kode token tersedia di GitHub dan Etherscan.


Link Github: https://github.com/MPCXPlatformLTD

Alamat Kontrak : https://etherscan.io/address/0xcd22b66827bd35c4a6375a960ef6c5d003f98cc1



---------------------------------------------------------------------------------------------


--------------------------------------------------------------------------------------------------------------------------------




PENTING:
Pendiri dan manajer kampanye berhak, mengubah aturan, menambahkan aturan, menolak kamu dari kampanye.
 
 
 *** Setiap masalah atau pertanyaan terkait dengan bounti, kamu dapat bertanya kepada saya di sini https://t.me/joinchat/HKzpNw7GALGgezy0GrTT9w atau posting masalahmu di sini sehingga saya bisa menyelesaikannya

** Kamu dapat bergabung dalam chanel Bounti saya untuk update terbaru tentang bounti yang sedang berlangsung dan Bounti Baru https://t.me/newsilikebounty


Thread ANN Asli: Di sini



Saya hanya berperan sebagai penerjemah thread ANN,thread Bounti dan Whitepaper dari MPCX dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

16  Local / Altcoins (Bahasa Indonesia) / [ANN] [ICO] LIGER Coin - Cryptocurrency Revolusioner untuk Kasino dan Game on: May 02, 2018, 06:27:50 AM
🔸 ICO LIGER COIN 🔸

➡️ Nama: LIGER COIN

🚀🚀 BONUS 40% SELAMA PREICO 🚀🚀


➡️ Website: https://www.ligercoin.com/
➡️ Whitepaper: https://www.ligercoin.com/wp-content/uploads/2018/03/white-paper-new.pdf
➡️ Telegram: https://t.me/TheLigerCoin
➡️ Video Produk: https://www.youtube.com/watch?v=K0muTTP81tA&t

🔸 Tentang LIGER COIN 🔸

Liger merupakan sebuah cryptocurrency unggulan yang benar-benar akan mengubah skenario Permainan Kasino Online dan Offline, portal Fantasi Sports, dan Taruhan Olahraga Langsung. Berbekal Teknologi Blockchain, Liger akan menghilangkan semua perantara dan menjadikannya permainan yang adil diantara pemain dan pedagang, membuat game menjadi lebih cepat dan lebih aman. Atribut unik dari sistem stake di mana Pemegang Token Liger dapat bermain dalam kasino favorit dan mendapatkan bagian dari pendapatan mereka melalui smart contract membuatnya menjadi kelas yang terpisah.

🔸 Mengapa Liger? 🔸

- Staking menciptakan peluang jangka panjang untuk mengumpulkan aset, menguntungkan Pemegang Token

- Mekanisme Pembakaran Token menghasilkan peningkatan permintaan di Exchange dan kenaikan harga Token yang konstan

- Pembelanjaan di Kasino atau POS tidak memiliki dampak negatif pada Peringkat Kredit

- Akuisisi pelanggan yang lebih mudah dan peniadaan biaya pemrosesan yang menguntungkan pedagang dan gamer

- Aplikasi Liger memungkinkan Gamer untuk berpartisipasi dari jarak jauh di meja Offline

🔸 Ketentuan Penjualan Token:🔸

➡️ Jumlah Total Token: 2,700,000,000 Token
➡️ Token Dijual di ICO = 2.025.000.000 Token
➡️ Hard Cap = 41 Juta €
➡️ Soft Cap = 4 Juta €
➡️ Token Ethereum ERC20
➡️ 1 Token LIGER = 0.025 €
➡️ Penjualan Pre-ICO Dimulai: 18 April
➡️ Penjualan ICO Dimulai: 11 Mei

🔸 Chanel Resmi LIGER COIN 🔸

➡️ Telegram ► https://t.me/TheLigerCoin
➡️Facebook ► https://www.facebook.com/TheLigerCoin/
➡️ Twitter ► https://twitter.com/TheLigerCoin
➡️Youtube ► https://www.youtube.com/channel/UCm0Ok5D_Zu95JhkveH3vUzQ
➡️Reddit ►https://www.reddit.com/r/ligercoin/
➡️Linkedin ►https://www.linkedin.com/company/13643830/
➡️Instagram ►https://www.instagram.com/ligercoinofficial/


Thread ANN Asli: Di sini



Saya hanya berperan sebagai penerjemah thread ANN,thread Bounti dan Whitepaper dari LIGERCOIN dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

17  Local / Altcoins (Bahasa Indonesia) / [ANN][ICO]Gold Mining Asset|Digitizing Gold Assets: Crypto-Based Gold Token on: April 25, 2018, 04:52:58 PM
Pengumuman:

BREAKING NEWS📢:

Sesuai dengan persyaratan KYC bagi para peserta bounti Goldma.

Proses verifikasi KYC akan langsung diproses melalui website Goldma. Tim sudah mengupgrade website untuk peserta bounti.

Formulir Google tidak akan digunakan lagi dan manajer meminta kepada semua peserta yang sudah melakukan verifikasi melalui formulir google, diharap untuk melakukan verifikasi ulang di website. Maaf untuk ketidaknyamanan ini!

Ini adalah revisi terakhir untuk proses verifikasi tersebut.

(OPSI LAINNYA): Peserta bounty dapat menggunakan dokumen di bawah ini sebagai Bukti Alamat.
NB: Dokumen harus DISETUJUI / Ditandatangani oleh Pengacara

Formulir Bukti Alamat: https://drive.google.com/open?id=1KFlQ8IV_m8PHurugB1Qmwf9-t_OH7lOo

Terima kasih







Thread ANN Asli: Di sini



Saya hanya berperan sebagai penerjemah thread ANN dan Whitepaper dari GOLDMA dan tidak bertanggung jawab terhadap segala kemungkinan yang akan terjadi dimasa depan. Posisi saya bukan sebagai salah satu anggota tim atau representasi dari proyek ini. Segala hal yang menyangkut invetasi, program bounti dan jalannya proyek ini bukan merupakan tanggung jawab saya. Sebelum mulai menerjemahkan, saya terlebih dahulu melakukan skreening dan investigasi terhadap proyek ini, meski demikian penyelidikan yang saya lakukan tidak bisa dijadikan dasar dan acuan terhadap segala kemungkinan buruk dimasa depan. Anda juga harus melakukan analisis dan investigasi sendiri.

18  Local / Altcoins (Bahasa Indonesia) / [ANN][ICO] Sleekplay - Reinventori Monetisasi Konten on: April 14, 2018, 01:15:00 PM
Karena dev tidak aktif di thread utama, maka untuk menghindari postingan spam, thread ini saya kunci.
Untuk semua pertanyaan silakan langsung menuju ke group telegran (https://t.me/sleekplay_official), terima kasih.











Ini adalah proyek Bountyhive yang terverifikasi. Bounti ini berada dalam escrow Bountyhive.


Thread ANN Asli: Di sini



19  Local / Altcoins (Bahasa Indonesia) / [ANN][ICO][CrowdFunding] GLODCoin-Mata Uang untuk Pengalaman Belanja Virtual 3D on: April 04, 2018, 07:01:02 AM
WEBSITE RESMI  |  VIDEO  |  WHITE PAPER
FACEBOOK  |  TWITTER



GLODCoin
Koin Berstandar ERC20 Ethereum



REVOLUSI PEMBELIAN TANPA UANG TUNAI!

PACULAH DAYA PEMBELIAN ANDA
KAMU BISA MENIKMATI PROSES YANG CEPAT, AMAN, DAN TRANSAKSI ONLINE YANG TERJANGKAU

MARI BERJALAN DENGAN KAMI
DAN PENGALAMAN PETUALANGAN BELANJA VIRTUAL 3D YANG MEMPESONA INI UNTUK DIRIMU SENDIRI!




ICO Dimulai : 15 APRIL 2018


Harga ICO : 1 GLOD: 0.00101317 ETH
Total Suplai : 2,100,000,000


WEBSITE RESMI  |  VIDEO  |  WHITE PAPER  
FACEBOOK  |  TWITTER


ANN ASLI DI SINI

 
20  Local / Altcoins (Bahasa Indonesia) / [ANN][ICO]Peur - Revolusi Marketplace dengan Luar Biasa [@BOUNTYHIVE.IO] on: April 03, 2018, 06:57:44 PM


















Ini adalah proyek Bountyhive yang terverifikasi. Bounti ini berada dalam escrow Bountyhive.


Thread ANN Asli: Di sini

Pages: [1] 2 »
Powered by MySQL Powered by PHP Powered by SMF 1.1.19 | SMF © 2006-2009, Simple Machines Valid XHTML 1.0! Valid CSS!