Bitcoin Forum
April 23, 2019, 09:08:42 PM *
News: Latest Bitcoin Core release: 0.17.1 [Torrent]
 
  Home Help Search Login Register More  
  Show Posts
Pages: [1]
1  Local / Токены / [ANN] ⭐️ EXCALIBUR OS ⭐️ Первая в мире управляемая ОС on: October 03, 2018, 04:48:42 PM


EXCALIBUR ОС
Первая в мире ОС с системой управления майнинга

Pre-ICO is LIVE
WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
REDDITGITHUBMEDIUMSLACK

🔊   Официальная продажа Excalibur ОС ANN  🔊

Официальная баунти Excalibur ОС  кампания: 100 000 000 XOS токены (~2 500 ETH) ждут тебя!
https://bitcointalk.org/index.php?topic=5036871

========================================
ICO капитал

Softcap: 5 000 ETH
Hardcap: 45 000 ETH





Очередь продажи токенов

🌟🌟🌟 Pre-ICO: 03.09 - 03.11.2018 | Цена : XOS = 0.000025 ETH | Бонус : 50% 🌟🌟🌟
ICO: 15.12 – 31.01.2018 | Цена : XOS = 0.000025 ETH | Бонус : 10-30%

========================================

Другие языки/size]
(Ссылки будут обновлены после перевода)
------------------
.• Китайский: (ANN, Whitepaper)
• Арабский: (ANN, Whitepaper)
• Японский: (ANN, Whitepaper)
• Русский: (ANN, Whitepaper)
• Корейский: (ANN, Whitepaper)
• Испанский: (ANN, Whitepaper)
• Вьетнамский: (ANN, Whitepaper )
• Немецкий: (ANN, Whitepaper )




ЗАДАЧА
______________


ПК являются неотъемлемой частью повседневной жизни миллиардов людей во всем мире. Они  производят большое количество функций, чем кто-либо мог себе представить всего несколько лет назад, но есть проблема с вирусом и защитой данных для пользователей ПК, данные крадутся и подвергаются атаке вирусами и хакерами[/b][/color].



РЕШЕНИЕ
______________


Операционная система Excalibur  имеет встроенную систему защиты от вирусов и противоугонную систему, которая позволяет пользователям иметь опыт работы с вирусами и системой защиты данных. Операционная система также решает проблему майнинга с помощью своей уникальной системы управления работами, которая может добывать и управлять вашей монетой и иметь систему редактирования скриптов, в которую вы можете добавить недавно выпущенную монету, просто добавив свой скрипт. Пользователи могут монетовать монеты с лучшей эффективностью из-за ее повышенной производительности, которая в полной мере использует эффективность аппаратного обеспечения.

         



КАК ЭТО РАБОТАЕТ
______________

Excalibur ОС чистый и незагроможденный, с оптимизированным интерфейсом, который ставит задачи, которые вы хотите выполнить прямо сейчас. У вас больше контроля над тем, где чаще всего использовать то, что вы хотите. Управление несколькими экранами проще. И мы улучшили поиск, чтобы вы могли быстро найти нужную информацию.
Мы определили некоторые ключевые темы, которые повлияли на наши усилия по инженерному проектированию и помогли нам сосредоточиться на том, где мы могли бы принести вам максимальную пользу:
    ➢ Аппаратные средства;
    ➢ Расширенное разнообразие и изощренность устройств;
    ➢ Рост мобильных вычислений;
    ➢ Дополнительные параметры подключения;
    ➢ Подключение нескольких ПК в домашних условиях;
    ➢ Больше цифровых носителей;
    ➢ Пользовательский интерфейс.

Совместимость приложений и устройств:
    ✚ Мы работали над минимизацией изменений в способах взаимодействия приложений и устройств с несколькими другими платформами;
    ✚ Мы создали исчерпывающий список наиболее широко используемых потребительских и бизнес-приложений, которые были протестированы на протяжении всего цикла разработки;
    ✚ Для непроверенных программ или приложений, разработанных внутри компании, Excalibur ОС предлагает ряд совместимых средств совместимости;
    ✚ Мы постоянно контролируем проблемы совместимости приложений во всей экосистеме Exalibur ОС;
    ✚ Мы также работаем над тем, чтобы устройства, совместимые с Windows, Mac, iOS, Android и Linux, также работали с Exalibur OС.

Революционный интерфейс пользователя и производительный дизайн:
Пользовательский интерфейс Excalibur ОС построен с концепцией чего-то нового и захватывающего, который будет наполнен настраиваемым пользовательским интерфейсом. ОС построена с тремя различными типами системного меню (меню «Пуск»), для всех типов пользователей либо Mac, либо пользователями Windows, включая пользователей Linux. Имея два разных типа меню боковой панели, вы можете переключиться на кого угодно. Дизайн основан на дизайне Lite. Загрузка и вход в операционную систему полностью настраиваются.
Идеи для дизайна были взяты и из текущих операционных систем, для улучшения дизайна пользовательского интерфейса. В настоящее время ОС также разрабатывается для Virtual Design (VR).

Особенности для определения:

1. Защита от вирусов и хакеров;
2. Пользовательский интерфейс;
3. Искусственный интеллект;
4. Безопасность;
5. Опыт, как никогда раньше;
6. Улучшает производительность оборудования;
7. Система управления майнинга и торговой деятельностью.

Суть Excalibur ОС:


00000000000000000000000000000000000000
Философия

• Надежность, безопасность, переносимость, совместимость
• Производительность важна: многопоточная, асинхронная.
• Общие средства, которые могут быть повторно использованы
1) Поддержка расширяемости в режиме ядра (лучше или хуже)
2) Обеспечить единые механизмы, которые могут быть разделены
3) Ядро / исполнительный раскол обеспечивает чистую модель расслоения
4) Выберите дизайн с архитектурным запасом
00000000000000000000000000000000000000
Особенности

• Многопоточность в технологической среде
• Полностью асинхронная модель ввода / вывода
• Планирование на основе потоков
• Унифицированное управление структурами данных ядра, ссылками на ядра, ссылками на пользователя (ручками), пространством имен, объектами синхронизации, загрузкой ресурсов, совместным использованием процессов
• Централизованный контрольный монитор безопасности на основе ACL
• Конфигурационное хранилище отделено от файловой системы
00000000000000000000000000000000000000
Режим

• EXOS (иначе «ядро»)
(a) Уровень ядра (реферат CPU)
(b) Исполнительный уровень (функции ядра ОС)
• Драйверы (модель расширения в режиме ядра)
(1) Интерфейс к устройствам
(2) Реализация файловой системы, хранилища, сетей
(3) Новые службы ядра
• HAL (уровень абстракции оборудования)
(1) Скрывает детали набора микросхем / BIOS
(2) Позволяет EXOS и драйверам работать без изменений





ПРЕИМУЩЕСТВА ДЛЯ ВЛАДЕЛЬЦЕВ ТОКЕНОВ
______________


Преимущества - это награды для обладателей токенов, которые инвестировали в нашу бизнес-модель или в токены. Мы будем предоставлять различные виды льгот держателям токенов, которые описаны ниже:

  • Рыночная цена ICO будет расти в ближайшем будущем, что будет выгодно для владельцев токенов в соответствии с точки зрения торговли.
    • Операционная система версия бета будет первоначально запущена для держателей токенов в 1 квартале 2019 года
    • Управление Excalibur ОС будет очень легким
    • Нет больше дорогих платежей за антивирус
    • Токены могут продаваться на международном уровне через Интернет
    • Токены имеют премию за ликвидность (> 1000-кратное улучшение во времени к ликвидности)
    • Прозрачность использования средств, условное депонирование может использоваться для проверки того, как средства расходуются после ICO
    • У певых участников будет больше ликвидности на ранних стадиях компаний
    • Ранний доступ к токену, который имеет потенциал для быстрого роста капитала
    • Участники, как правило, являются первыми пользователями токена - таким образом, в отличие от акций компании, чьи продукты никогда не использовались, по иронии судьбы, наши токены будут более ощутимыми, чем ценные бумаги



ДОРОЖНАЯ КАРТА
______________

.2014, Q-4
Предложена идея проекта

.
2015, Q-1
Начата сборка и разработка ОС Excalibur
.2015, Q-4
Ядро развития было закончено в октября                        

.
2016, Q-1
В феврале готов пользовательский интерфейс
.2016 Q-2
Была построена система защиты от вирусов для ОС Excalibur

.
2016, Q-3
Команда начала работу над Majon Part. Все силовые платформы в единой платформе
.2017, Q-3
Была завершена разработка платформы

.
2018, Q-1
Началось развитие системы управления майнингом
.2018, Q-2
Excalibur ОС официально существует

.
2018, Q-3
PRE ICO В сентябре 2018 года
.2018, Q-4
ICO и тестирование версии BETA

.
2019, Q-1
BETA версия Exalibur ОС будет выпущена и токены будут доступны для покупки
.2019, Q-3
Версия BETA с искусственным интеллектом (ИИ), подобно SIRI и Cortana

.
2019, Q-4
Будет запущена версия BETA со следующим обновлением, которая будет виртуальной реальностью



ДЕТАЛИ ТОКЕНА
______________


.Название:EXCALIBUR токен
.Сокращение:XOS
.Платформа:Ethereum
.Тип:Утилита
.Total supply:4 000 000 000 XOS
.Softcap:5 000 ETH
.Hardcap:45 000 ETH
.Продажа токенов:03.09.2018 - 31.01.2019
.Принятая покупка:  ETH
.Цена:1 XOS = 0.000025 ETH
.Минимальная инвестиция:   0.25 ETH
.Страна:Индия
.Whitelist/KYC:KYC
.Ограничения:США, Канада, Северная Корея, Китай



РАСПРЕДЕЛЕНИЕ ТОКЕНОВ
______________


             
РАСПРЕДЕЛЕНИЕ ФОНДОВ
______________





ПРОДАЖА ТОКЕНОВ
______________


.
PHASE

         Pre-ICO          
ICO
ПРОДОЛЖИТЕЛЬНОСТЬ

            03.09 - 03.11.2018            
15.12.2018 - 31.01.2019
ТОКЕНЫ

      200 000 000      
200 000 000
400 000 000
400 000 000
800 000 000
ЦЕНА

      1 XOS = 0.000025 ETH      
1 XOS = 0.000025 ETH
1 XOS = 0.000025 ETH
1 XOS = 0.000025 ETH
1 XOS = 0.000025 ETH
БОНУС

      50%      
30%
25%
15%
10%



ОСНОВНАЯ КОМАНДА
______________

Команда ОС Excalibur сочетает в себе страсть к отраслевой экспертизе и проверенную репутацию в области финансов, разработки, маркетинга и лицензирования.


Suraj Singh Bisht
Основатель и генеральный директор ОС Excalibur

 
   

Neeraj Pal Singh Karakoti
Соучредитель и старший разработчик

 
   

Anmol Agarwal
Архитектор приложений для настольных ПК
& Разработчик эксперт C++

 
   

Dr. Sanjay Agarwal
Разработчик настольных и встраиваемых программ

 


Kavita Gariya
Главный научный разработчик

 
   

Sajal Manglik
Майнинг менеджмент и разработчик Node.js

 
   

Faheem Ahamad
CMO и системный разработчик

 

Dr. Sartaj Hussain
Аналитик по автоматизации тестирования и безопасности

 
   

Brijita Solanki
Майнинг менеджмент и разработчик Node.js

 
   

Trilok Singh
Майнинг менеджмент и разработчик PHP

 



КОНСУЛЬТАНТЫ
______________


Giovanni Casagrande
Эксперт ICO (топ 30)

 
   

Giacomo Arcaro
Эксперт и советник ICO

 
   

Sydney Ifergan
CMO | Эксперт сообщества Crypto & ICO | Консультант FX |
Специалист по цифровому маркетингу | Советник ICO

 
   

Andrew Chung
Продавец криптовалюты, инвестиции

 


Tinh Tran
Менеджер по коммуникациям и советник

 
   

Nozomu Nakazato
ЯКМ-японский крипто маркетинг - консультант ICO проекта

 
   

MJ Paul
ICO эксперт и консультант

 
<br
2  Local / Токены / [ANN][ICO]s QUANTOCOIN - ПЕРВЫЙ РЕАЛЬНЫЙ БЛОКЧЕЙН БАНК on: August 31, 2018, 08:38:21 AM


QUANTOCOIN
Будущее финансовых услуг

DTO реально
WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
REDDITGITHUBMEDIUMYOUTUBE

🔊  Официальная цепочка ANN Quantocoin    🔊

Официальная Quantocoin баунти кампания: 1 000 000 QTCt токенов (~$1 000 000 USD) ждут тебя!
https://bitcointalk.org/index.php?topic=4956093

========================================
ICO КАПИТАЛ

💥 Softcap: $3 000 000 USD (достигнуто) 💥
Hardcap: $70 000 000 USD
✈️✈️✈️ Raised: $11 003 700 USD ✈️✈️✈️


     


РАСПИСАНИЕ ПРОДАЖИ ТОКЕНОВ

Частная предварительная продажа: 18 - 30.11.2017 | Распределено 1 856 000 QTCt | Поднято $1 230 000 USD
ICO: 01.12.2017 - 28.02.2018| Распределено 16 460 000 QTCt | Поднято $9 803 700 USD

🌟🌟🌟 DTO: 01.07.2018 - 30.04.2019 | Ценв : 1 QTCt = $1.2 USD 🌟🌟🌟

========================================

Другие языкиs
(Ссылки будут обновлены после перевода)
------------------
.• Китайский: (ANN, Whitepaper)
• Арабский: (ANN, Whitepaper)
• Японский: (ANN, Whitepaper)
• Русский: (ANN, Whitepaper)
• Корейский: (ANN, Whitepaper)
• Испанский: (ANN, Whitepaper)
• Вьетнамский: (ANN, Whitepaper )
• Немецкий: (ANN, Whitepaper )




Задача
______________


   •  Нынешняя финансовая система поддерживается крупными финансовыми учреждениями, которые предоставляют финансовые услуги. Это означает, что банки, страховые компании, компании с кредитными картами, компании по финансированию жилья, компании по переводу денег и т. д., которые являются архаичными и имеют низкое проникновение.

   • Принятие криптовалюты в нормальную жизнь: теперь практически невозможно заплатить любой криптовалютой всегда или делать переводы и т. д., кроме того, обработка транзакций для криптовалюты против fiat практически не существует:
     +   Ограниченная возможность делать платежи с использованием криптовалюты
     +   Торговые потери, вызванные высокой волатильностью на быстром рынке
     +   Комплексный и дорогостоящий процесс
     +   Продажа любого криптовалюта по требованию приведет к высоким потерям




РЕШЕНИЕ
______________


Quantocoin разработала модель следующего поколения для будущего финансовых услуг и цифрового банкинга. Эта модель использует технологию Blockchain наряду со смартфонами, а также новую систему биоидентификации, которая будет использоваться для обеспечения безопасных и надежных учетных записей для каждого пользователя. Это проект по развитию будущего крипто-финансового мира. Его основной задачей является интеграция и подключение QTC в традиционный финансовый мир и создание единого шлюза через платформу QTC для пользователей, трейдеров, инвесторов и финансовых учреждений с целым рядом дополнительных услуг.

Quantocoin - платформа для будущего финансирования, которая построена на вершине блока Waves. Это ускоряет рост не банкиров, предлагая инструменты и услуги, которые экономят как время, так и ресурсы.




КАК ЭТО РАБОТАЕТ
______________


Система QTC была создана как сложная среда, которая объединяет все отдельные сервисы в одном месте. Хотя отдельные услуги полностью независимы, их сочетание создает простую, ясную и централизованную экосистему. Организационное доверие к платформе предоставляет услуги, которые добавляются или удаляются с помощью функции перетаскивания. Вся система построена на единой точке доступа, которая является платформой QTC, которая легко доступна через учетную запись клиента.

Функции банка QTC:
   ➢   Кошелек - обмен, переводы, денежные переводы
   ➢   Instant Cash - криптовалюта для повседневных пользователей
   ➢ Кредитование и микрофинансирование - протокол кредитования QTC
   ➢ Социальные платежи - Высокий безопасный внутренний чат
   ➢ Crypto Assets Portfolio - Алгоритм управления портфелем портфелей
   ➢ Geofencing - уникальные функции близости


Мобильное приложение QTC:
Мобильное приложение QTC станет доступным для загрузки через рынок IOS или Android, и клиенты, наконец, смогут использовать основные криптовалюты для оплаты любых товаров или услуг на основе fiat мгновенно, легко и быстро на любых POS-терминалах с технологией NFC или через наши QTCBeacons.
QTC будет в полной мере использовать это глобальное бесконтактное явление, но вместо того, чтобы использовать его для традиционного канала оплаты, используя валюту fiat, QTC будет использовать его для криптовалют через персональные смартфоны.

Мы объединяем три лучших мировых технологии: NFC, QR коды и Beacon в одном приложении (гибридное приложение). Quantocoin с мобильным приложением QTC превращает каждый iPhone и Android в сложную банковскую платформу.








• Не требуется приема GPS или телефона
• Широкий диапазон обработки по сравнению с Near Field Communication (NFC)
• Нет необходимости в специализированном оборудовании для продажи (POS)
• Технология, поддерживаемая основными брендами мобильных устройств
             

Протокол кредитования - первое мгновенное приложение наличных
Протокол QTC кредитования является следующим шагом к успешному развитию революционной платформы QTC, которая обеспечивает немедленную наличность с помощью пула криптовалюты. Теперь участники могут использовать мобильное приложение QTC для хранения / хранения своих криптоактивных активов без необходимости их продажи.
Конечным пользователям разрешается использовать все свои криптоактивные активы (QTC, BTC, ETH и т. Д.), Чтобы мгновенно получать денежные средства, которые можно потратить через платежную карту и безналичное бесконтактное мобильное приложение QTC. В течение этого кредитного периода портфель активов вкладчика используется как залог, динамично и мгновенно управляемый, предоставляя возможность для получения прибыли и долгосрочного роста портфеля.


• Мгновенные деньги
• Продвижение денежных средств можно автоматически запрашивать через приложение для смартфонов.
• Покупка, расходы
• Приложение QTC может разрешить покупки с более чем 70 миллионами торговцев или снятием наличных в более чем 3,8 миллионах банкоматов по всему миру. У этого есть потенциал более 5 миллиардов мобильных пользователей.
• Ответственный подход к портфелю криптовалют
• Участники могут продолжать получать выгоду от невероятной оценки рынка, как было замечено в предыдущие годы, и моль рядом с положительным прогнозом 2018 года.
• зарабатывать деньги, даже если вы их тратите.
• Рост портфеля - Залоговые активы работают за вас благодаря активному управлению портфелем
             





ДОРОЖНАЯ КАРТА
______________


.
ФЕВРАЛЬ 2016
Lite документы, юридическая структура и структура, установление партнерских отношений, надежное техническое партнерство
.ГОД 2016
Направление стратегии бизнес-плана, разработка плана проекта, лицензирование и создание сети компаний

.
КВАРТАЛ 1 2017
Маркетинговый план, набор талантов, план планирования и развития платформы
.КВАРТАЛ 2 2017
Регистрация IP и TM, нормативная база, план выполнения требований, документы

.
КВАРТАЛ 3 2017
Консультативный совет устанавливает партнерские отношения с банками и поставщиками ликвидности, развитие общин, внедрение послов
.ДЕКАБРЬ 2017
ICO

.
КВАРТАЛ 4 2017
Аудит безопасности, разработка UI/UX, применение для листинга на основных обменах криптовалюты, запуск новых рынков
.КВАРТАЛ 1 2018
Представление на листинг QTC на основных биржевых биржевых биржах, запуск новых рынков (Азия, Ближний Восток, Африка), тестовая платформа

.
КВАРТАЛ 2 2018
Первые тесты версий приложений, разработка кодов и тесты, применение для EMI, авторизация PI в FCA
.КВАРТАЛ 3 2018
Запуск DTO, запуск приложения, разработка приложений для клиентов, тестирование протокола кредитования

.
КВАРТАЛ 4 2018
Начало денежных переводов, полная функциональность кошелька, первый qtcBeacon, авторизация для деятельности от FCA, предоставление документов для получения банковской лицензии
.КВАРТАЛ 1-2 2019
Расширение сети Merchants, гибридное тестирование приложений, реализация протокола кредитования, robo-advisors, конец DTO

.
КВАРТАЛ 3 2019
Получение банковской лицензии, интеграция с быстрой системой
.КВАРТАЛ 4 2019
Внедрение гибридного приложения, полная функциональность торгового центра, созданы собственные средства обмена




ТОКЕН ДЕТАЛИ
______________


.Название токена:Quantocoin token
.Обозначение:QTCt
.Платформа:WAVES
.Тип:Утилита
.Общий запас:99 000 000 QTCt
.Softcap:$3 000 000 USD
.Hardcap:$70 000 000 USD
.Продажа токенов:18.11.2017 - 30.04.2019
.Принятая покупка:  ETH, BTC, Waves, fiat
.Цена:1 QTCt = $1.0 - 1.2 USD
.Минимальные инвестиции:    100 QTCt
.Страна:Великобритания
.Whitelist/KYC:KYC
.Ограничение на территорих:Южная Корея



РАСПРЕДЕЛЕНИЕ ТОКА
______________


.DTO   
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||   71.3%
.ICO   
|||||||||||||||||||   18.5%
.Команда 
||||||||   8.5%
.Консультанты 
|    1.3%
.Резерв   
|   0.5%


РАСПРЕДЕЛЕНИЕ ФОНДОВ
______________


.Разработка платформы
|||||||||||||||||||||||||||||||||||||||||||||||||||||   53%
.Юридическое структурирование, регулирование, налоговые консультации 
|||||   5%
.Стоимость, связанная с разработкой ПО
|||||||||   9%
.Счета за обслуживание 
||||   4%
.Управление и команда   
|||||||||||||||   15%
.Общественная деятельность 
|||   3%
.Баунти кампания
||||   4%
.Исследование   
|||||||   7%



ПРОДАЖА ТОКЕНОВ
______________


.
ЭТАП

Частная предварительная продажа
ICO

          DTO         
ПРОДОЛЖИТЕЛЬНОСТЬ

18 - 30.11.2017
01.12.2017 - 28.02.2018

             01.07.2018 - 30.04.2019             
ТОКЕНЫ

1 856 000 QTCt
16 460 000 QTCt

       70 000 000 QTCt       
ПОДНЯТО

$1 230 000 USD
$9 803 700 USD

       -       



ОСНОВНАЯ КОМАНДА
______________


Alexander
Соучредитель

 
     

Pablo Viktor
Партнер

 
     

Anthony
Юрисконсульт

 
     
 

 
     
 
     
 
     
 



 
     
 
[/center]


Представители
______________


 
     
 
     
 





Будущее финансовых услуг

DTO is LIVE
WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
REDDITGITHUBMEDIUMYOUTUBE

*Formatting by MS Support
3  Local / Токены / [ANN][ICO][BOUNTY] SERVADVISOR.CO-РЕКОМЕНДАЦИОННАЯ ПЛАТФОРМА ДЕЦЕНТ&# on: August 05, 2018, 06:29:41 PM

Местные потребители услуг и путешественники

WEBSITEBOUNTYДОКУМЕНТАЦИЯTELEGRAMTWITTERFACEBOOK
REDDITGITHUBMEDIUMYOUTUBE


🔊    Официальная поддержка ANN-потока ServAdvisor    🔊

Official ServAdvisor Bounty кампания I: 9 750 000 SRV токенов (~150 ETH) ждут тебя!
https://bitcointalk.org/index.php?topic=4715637

========================================
ICO КАПИТАЛ

Минимальная сумма средств: нет минимальной суммы
Максимальная сумма средств: 30 000 ETH



РАСПИСАНИЕ ПРОДАЖИ ТОКЕНОВ

...скоро... Предварительная продажа: 10.09.2018 - 10.10.2018 | Цена : 1 ETH = 65 000 SRV ...скоро...
Краудсейл: 12.11.2018 - 12.12.2018
Краудсейл этап 1: 1 ETH = 60 000 SRV
Краудсейл этап 2: 1 ETH = 57 500 SRV
Краудсейл этап 3: 1 ETH = 50 000 SRV

========================================

Другие языки
(Ссылки будут обновлены после перевода)
------------------
.• Китайский: (ANN, Белая книга)
• Арабский: (ANN, Белая книга)
• Японский: (ANN, Белая книга)
• Русский: (ANN, Белая книга)
• Корейский: (ANN, Белая книга)
• Испанский: (ANN, Белая книга)
• Вьетнамский: (ANN, Белая книга)
• Немецкий: (ANN, Белая книга)




ЗАДАЧА
______________


Несмотря на важность онлайн-обзоров, привлечение честной обратной связи органически немного сложнее, чем кажется. Привилегированные пользователи с большей вероятностью напишут обзор, как только услуга будет потреблена, тем самым значительно увеличив количество уникальных персонализированных обзоров.

В то же время большинство таких обзоров имеют тенденцию быть положительными, в то время как стандартным подходом является то, что потребители услуг «без вознаграждения» скорее будут критиковать обзор на большинстве популярных сайтов только в том случае, если они не удовлетворены обслуживанием. Недовольство является единственной мотивацией для многих потребителей услуг. В то же время большинство довольных потребителей услуг не мотивированы лично для проведения обзора. В результате многие розничные торговцы/поставщики услуг имеют более низкие оценки, чем их реальное качество обслуживания.


Проблемы рынка:

   •   Простота использования;
   •   Качество отзывов;
   •   Информационная перегрузка;
   •  Нет прямой связи между розничными торговцами, поставщиками услуг и пользователями.




РЕШЕНИЕ
______________


  ServAdvisor направлен на создание постоянно обновляемой и поддерживаемой в режиме реального времени всемирной платформы надежных, точных и полезных сведений о розничных продавцах и поставщиках услуг.

  ServAdvisor также нацелен на создание базы данных о привычках и предпочтениях потребителей услуг, из которых искусственный интеллект может предоставить каждому индивидуальному пользователю индивидуальные уникальные рекомендации, которые специально настроены для них. С искусственными рекомендациями на основе разведки и на основе blockchain информации высокого качества, ServAdvisor станет новым стандартом для обнаружения платформ обслуживания с умной и достоверной информацией.




КАК ЭТО РАБОТАЕТ
______________



    ServAdvisor - это первая в мире платформа для оценки децентрализованных услуг, основанная на уникальных предпочтениях клиентов.ServAdvisor использует расширенную реальность (РР), искусственный интеллект (ИИ), смарт-контракты и оригинальный токен, создавая революционную экономику на основе токенов, соединяющую потребителей услуг и розничных торговцев/поставщиков услуг в одну экосистему.

ServAdvisor App состоит из следующих основных компонентов:

    ➢ Расширенная реальность с отслеживанием GPS
    ➢ Искусственный интеллект для оптимизации предпочтений пользователей
    ➢ Продвинутые потребители услуг
    ➢ Стимулирование рекламы от продавцов / поставщиков услуг к потребителям, стоящих у их дверей
    ➢ Модуль обмена паролями Wi-Fi
    ➢ Многоязычные преимущества
    ➢ Нажмите, чтобы отсканировать
    ➢ Друзья и эксперты  ServAdvisor




00000000000000000000000000000


Дополненная реальность
Технология реального времени, которая работает путем наложения подробной информации об окружении пользователя
00000000000000000000000000000


Умный договор
Позволяет пользователям ServAdvisor стимулировать их потребление услуг.
00000000000000000000000000000


Мобильный
Все действия от добавления продавца/поставщика услуг к написанию отзыва должны выполняться с помощью мобильных устройств.
00000000000000000000000000000


Применен ИИ
Специальный ИИ используется для предоставления быстрых и надежных пользовательских услуг.

000000000000000000000000000000000000


Пиринговый
Благодаря взаимному доступу и прямой связи с клиентами мы меняем способ общения продавцов/поставщиков услуг с потенциальными пользователями.
000000000000000000000000000000000000


Децентрализованная
При децентрализованной архитектуре экосистема становится более надежной и менее подверженной внешним воздействиям.
000000000000000000000000000000000000


Рыночная площадка
Большое количество сервисных предложений с простотой использования до никогда не было.



ВЫГОДЫ
______________

⭐️ Для потребителей услуг:

   ServAdvisor создаст по-настоящему глобальную, высококачественную, децентрализованную информацию о поставщиках и поставщиках услуг и платформу рекомендаций на основе расширенной реальности и искусственного интеллекта, чего раньше никогда не было с централизованными услугами.

  Это дает огромные преимущества как пользователям, так и розничным торговцам/поставщикам услуг, и позволяет пользователям зарабатывать деньги, потребляя услуги, которые адаптированы ИИ для соответствия их предпочтениям.

  Пользователи будут вознаграждены за то, что они внесли свой качественный контент и информацию в приложение, даже получая часть рекламного взноса в ресторанах, и смогут использовать деньги, которые они получают от своих взносов, чтобы потреблять другие услуги или даже переводить деньги. Платформа также помогает пользователям находить новые и захватывающие услуги, которые им обязательно нравятся, помогая им обогащать свою повседневную жизнь.


⭐️ Для продавцов/поставщиков услуг:

  Платформа ServAdvisor предоставит розничным торговцам/поставщикам услуг новый и очень целевой канал для отправки маркетинговых сообщений потребителям, буквально стоящим у двери. Он также предоставит розничным торговцам/поставщикам услуг доступ к ценным совокупным данным об этих покупательских привычках этих потребителей. Это становится устойчивым механизмом для розничных продавцов/поставщиков услуг, чтобы поддерживать лояльность клиентов, предоставлять богатый продукт и рекламную информацию, чтобы влиять на решения о покупке.

• Прямая связь с клиентом - позволяет розничным торговцам/поставщикам услуг доставлять сообщения своим потребителям, стоящим у их двери
• выражайте благодарность своему драгоценному клиенту
• Потребительская демографическая и аналитическая аналитика поведения - предлагает расширенный набор аналитики, который предоставляет розничным торговцам / поставщикам услуг доступ к комплексным потребительским шаблонам и тенденциям
• Целенаправленный персонализированный маркетинг - предоставление розничным торговцам / поставщикам услуг мощного инструмента для продажи потребителям своих услуг на основе времени, местоположения и критериев поведения, предоставляемых ИИ
• Готовая программа лояльности - позволяющая розничным торговцам/поставщикам услуг вознаграждать потребителей в виде ServCoins за участие в своих сервисах в приложении ServAdvisor
• Интеграция социальных сетей - позволяет розничным торговцам/поставщикам услуг поощрять своих потребителей подписываться и взаимодействовать со своими каналами социальных сетей






ДОРОЖНАЯ КАРТА
______________


.
Q3 2017
Разработка идей, формирование технической спецификации.
Здание команды.
.    Q4 2017
   Концептуальный дизайн.

.
Q3 2018
Предварительная продажа.
.    Q4 2018
   Альфа-версия релиз.
   Крайдсейл.

.
Q1 2019
Маркетинговые магазины/поставщики услуг.
Листинг на биржах.
Полномасштабная разработка, бета-версия.
.    Q2 2019
   10 млн. пользователей, более 1 млн. розничных продавцов/поставщиков услуг.

.
Q3 2019
              Открытие представительств в США, Азии.
.    Q4 2019
   50 млн. пользователей, подключено более 5 млн. розничных торговцев/поставщиков услуг.




ДЕТАЛИ ТОКЕНА
______________

  
ServCoins являются токенами полезности, которые станут валютой, которая позволяет розничным торговцам и поставщикам услуг использовать эту мощную распределенную платформу, которая будет влиять и вознаграждать потребителей за разумный выбор.

.Название токена:ServCoin токен
.Бегущая строка:SRV
.Платформа:Ethereum
.Тип:Утилита
.Общий запас:2 000 000 000 SRV
.Минимальный капитал:нет минимального капитала
.Максимальный капитал:30 000 ETH
.Продажа токенов:10.09 - 10.10
.Принятая покупка:  ETH
.Цена:1 ETH = 50 000 - 65 000 SRV
.Минимальная инвестиция:   0.1 ETH
.Страна:Германия
.Белый список/KYC:Да



РАСПРЕДЕЛЕНИЕ ТОКЕНОВ
______________


             
РАСПРЕДЕЛЕНИЕ ФОНДОВ
______________





ПРОДАЖА ТОКЕНОВ
______________


.
ЭТАП

         Предродажа          
Краудсейл
Краудсейл этап 1
Краудсейл этап 2
Краудсейл этап 3
ПРОДОЛЖИТЕЛЬНОСТЬ

            10.09 - 10.10            
12.11 - 12.12
ДОСТУПНО ТОКЕНОВ

      195 000 000 SRV      
1 495 000 000 SRV
ЦЕНА

      1 ETH = 65 000 SRV      

1 ETH = 60 000 SRV
1 ETH = 57 500 SRV
1 ETH = 50 000 SRV
МАКСИМАЛЬНЫЙ КАПИТАЛ

      3 000 ETH      

10 000 ETH
20 000 ETH
30 000 ETH



ОСНОВНАЯ КОМАНДА
______________

ServAdvisor Core Team сочетает в себе страсть к знаниям в области IT-индустрии и проверенную репутацию в области финансов, развития бизнеса и маркетинга. Из 20 профессионалов, работающих над проектом, мы с гордостью представляем нашу основную команду.




КОНСУЛЬТАНТЫ
______________

4  Local / Токены / [ANN][ICO][BOUNTY] SERVADVISOR.CO-РЕКОМЕНДАЦИОННАЯ ПЛАТФОРМА ДЕЦЕНТ& on: August 05, 2018, 06:16:26 PM
INVALID BBCODE: close of unopened tag in table (1)
5  Alternate cryptocurrencies / Announcements (Altcoins) / [ANN][ICO][BOUNTY] SERVADVISOR.CO-РЕКОМЕНДАЦИОННАЯ ПЛАТФОРМА ДЕЦЕНТ&# on: July 25, 2018, 10:06:09 AM
INVALID BBCODE: close of unopened tag in table (1)
6  Alternate cryptocurrencies / Announcements (Altcoins) / [ANN] NVIS - Invisible internet - Pre-ICO Jun. 20 - Aug. 31 on: July 24, 2018, 08:34:48 AM

NVIS

A Distributed Network of VPNs
The Invisible Internet™


Pre-ICO is LIVE
》》》 《《《


WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
SLACKMEDIUMYOUTUBE


🔊    Official NVIS ANN thread    🔊

Official NVIS Bounty campaign : NVIS Tokens (~1000 ETH) are waiting for you!
https://twitter.com/BountyTreesDrop/status/1013576501676081154

========================================
ICO CAPS

Softcap: 500 ETH
Hardcap: 5 000 ETH




TOKEN SALE SCHEDULE

🌟🌟🌟 Pre-Sale: 20.06.2018 - 31.08.2018 | Price : 1 NVIS = 0.012-0.017 ETH 🌟🌟🌟
Main-Sale: N/A | Price : N/A

========================================

Other Languages
(Links will be updated after the translation)
------------------
.• Chinese : (ANN, Whitepaper)
• Arabic : (ANN, Whitepaper)
• Japanese : (ANN, Whitepaper)
• Russian : (ANN, Whitepaper)
• Korean : (ANN, Whitepaper)
• Spanish : (ANN, Whitepaper)
• Vietnamese : (ANN, Whitepaper )
• German : (ANN, Whitepaper )




PROBLEM
______________


Despite the blockchain scale, nodes are individually subject to Denial of Service attacks that can take down strategically significant nodes and risk overwhelming other nodes as transactions are processed suboptimally. Vulnerabilities in TCP/IP network services can be a major weakness in blockchain networks. Network vulnerability scanners, such as Nessus by Tenable, and online databases, including Common Vulnerabilities and Exposures (CVE) contain thousands of publicly known vulnerabilities, exploits, backdoors, and trojans in network services and applications. The Internet is founded on TCP/IP, and the vast body of network implementations and applications make it infeasible to use other protocols. Because of the diversity of hosts and network configurations, each blockchain node is managed by different individuals and organizations that have wide variance in the level of sophistication of administrators with respect to network security.

More of our lives are transferred onto the Internet daily. This creates more opportunity for our data to be stolen, hacked, filtered or misused. Privacy has become almost impossible. There is also increased data vulnerability. One of the main forces driving the market for privacy and security solutions is the vast market to collect or steal and sell personal information.

VPN can be used to provide a security layer to both private and public networks such as WiFi Hotspots and the Internet. Organizations operating in healthcare and telecommunication industry deal with sensitive information that needs to be protected constantly. Hackers are mostly targeting these industries due to very high price of data in black market. The same study shows that “currently, the world is experiencing more than half million attacks every minute, which will rise due to high technology proliferation”.





SOLUTION
______________


The solution NVIS proposes is to have a blockchain with integrated peer-to-peer Layer 2 encryption between nodes. Product, SafeConnect L2P2P is a layer 2 over layer 3 VPN so from the inner perspective of the node, all ports are available.

From the outer perspective of the node (the Internet side), all TCP ports are closed and filtered by iptables, except for the port used as a funnel for communication with a named community of peers.

The benefits of this architecture include:

   ●   Reducing the outside attack surface
   ●   Cloaking inter-node communication
   ●   Normal intra-node communication
   ●   Sealing all unused ports
   ●   Eliminating threat of external packet-injection
   ●   Improves the uptime and performance of blockchain nodes




HOW IT WORKS
______________

VPN service consumer find and pay service providers in TLC SafeConnect Network by using built-in smart contract based Identity, Service Discovery and Payment services. The network itself is cloaked, and nodes use the Ethereum blockchain for censorship resilient distributed storage and transactional processing needs. The TLC SafeConnect Network will use Registered Identities to enable means of creating limited trust when engaging with services and account payments.


Core components:

   ➢   Ethereum allows the TLC SafeConnect Network to run decentralized code with smart contracts, enabling reliable services and payment handling.
   ➢   Identity service and database of registered identities will be added to ensure the proper identity acknowledgement between client and service provider.
   ➢   Discovery service and database of available services will be created to announce VPN services availability.
   ➢   Payment service and database of balances will be developed to secure promise-based micropayments for services.



00000000000000000000000000000


00000000000000000000000000000


00000000000000000000000000000

Decentralized
The TLC Secure Network VPN is powered by SafeConnect, a L2P2P networking. Infinitely Scalable. with a peer to peer connection, there is no single point of failure.
Open Source
In order to maintain network transparency, the source code is 100% visible so we can continue to improve as a community. Join our team on GitHub or Slack.
Secure
The core of the network is based off of the SafeConnect VPN which has been operated & industry test. A powerful network that ensures secuirty on a commercial scale.



VALUE PROPOSITIONS
______________


Security: Joining TSN gives users an "invisibility cloak" for host computers, protecting vital system services (such as blockchain nodes, web services and data sources) from port and protocol hacking and costly, disruptive DDoS attacks or theft. Hackers can't hack what they can't see.

Privacy: This will be a key competitive edge as well as core service of TSN. Participating nodes will have the ability to switch off the public Internet and use only TSN, or Communities they join or create. This means your shared services can reach just your group, or millions. Ideal for finance and ad-hoc networks for smart contracts and trading partner agreements that MUST be private.

The Invisible Internet: TSN will have it's own DNS, DHCP and IP management, with it's own domain name registration service and distributed firewalls.  In effect, it will be a brand new Internet. This offers boundless entrepeneurial opportunities for auction and sale of high value domains.

Want google.com ? You can own it on TSN.

Content:  You can provide ANYTHING and do EVERYTHING. The unique community name feature of TSN will allow for Content Marketing. Operate a marketplace,  or stream video, music and audio, TSN has opportunities for negotiation with premium content providers to accept NVIS as a universal access token for pay-per-view or subscriptions. This will allow TSN to become similar to a global cable service for a vast range of programs and online events.


   



ROADMAP
______________


Pre-ICO: 20 June 2018 - 1 August 2018

Tokens will be distributed to represent 10% of the supply and the price of the ICO.


Trading capability:  August 2018

Convenient NVIS smartphone wallets and listing on exchanges will permit NVIS to expand market capitalization.


Initial Coin Offering: August 2018

30% of the tokens will be distributed to solve the capital issue so that we can improve and expand the network.


Token redeeming:  Fall 2018

After the ICO, private blockchain use-tokens issued for bounties, etc. can be redeemed for NVIS trading tokens. This will allow us to offer high value services.


Blockchain hosting: late 2019

The launch of services related to blockchain hosting and alternative crypto token support.


New type of money: 2020

The synergy between blockchain hosting and payment products will offer new types of services linked usage tokens as a medium of exchange.




TOKEN DETAILS
______________

The internal cryptocoin will be used to access the network and to pay for premium services and content. The ecosystem for token use is:
● End Users TSN will pay users with NVIS tokens for access. They may purchase NVIS for premium content and services.
● Miners Earn various utility tokens on the TLC Secure Private Blockchain from PoW
● Node Operators will be given NVIS incentives to add nodes/recruit other operators of other blockchains.

.Token name:Invisible Internet
.Ticker:NVIS
.Platform:Ethereum
.Type:Utility
.Total supply:100 000 000 NVIS
.Softcap:500 ETH
.Hardcap:5 000 ETH
.Token Sale:20.06 - N/A
.Accepted purchase:  ETH, BTC
.Price:1 NVIS = 0.012 - 0.017 ETH
.Minimum investment:    0.1 ETH
.Whitelist/KYC:Yes
.Restricted areas:USA, China, Korea, Pakistan



TOKEN ALLOCATION
______________


.Pre-sale   
|||||   5%
.Private-Sale   
||||||||||   10%
.Public sale   
|||||||||||||||||||||||||   25%
.Bounties and advisors   
|||||   5%
.Team and planned employees   
||||||||||||||||||||   20%
.Reserve for Future Expansion   
|||||||||||||||||||||||||   25%
.Founders   
||||||||||   10%



FUNDS DISTRIBUTION
______________


.Core development     
||||||||||||||||||||||||||||||||||||||||   40%
.Operational   
|||||||||||||||||||||||||   25%
.Marketing and sales   
|||||||||||||||||||||||||   25%
.Legal and compliance   
||||||||||   10%



TOKEN SALE
______________


.
PHASE

          Pre-ICO         
Token-Sale
DURATION

             20.06 - 01.08             
N/A
TOKEN AVAILABLE

       2 500 000 NVIS       
N/A
PRICE

       1 NVIS = 0.012 - 0.017 ETH       
N/A
SOFTCAP

       500 ETH       
N/A



CORE TEAM
______________

TLC Secure, Inc. is a network security products and consultancy startup in Northern California, USA. Among our products is WirelessWall, a proven, multi-platform FIPS certified layer 2 encryption technologies used by government and large enterprises to secure wireless campus and sensor networks. We also created SafeConnect, an award-winning fast, efficient layer 2 over layer 3 VPN with built-in firewall.


Phil Smith
CTO
Phil is Founder and chief architect with expertise in security, networking, ISP and blockchain. He has overr 30 years in lead roles at NASA, HP, Cisco, Lawrence Livermore National Lab and other research labs and commercial projects as well as Space Shuttle and satellite communications and large network projects.
 
     

John Matthesen
CEO
John is a serial entrepreneur, with global operations and sales experience in the US, Europe and Asia. As part of the startup teams at Sybase and Commerce One, he held numerous positions, including CIO, VP of Asia...
 
     

Larry Karisny
CBDO
Larry is an author and expert in Smart Grid and critical infrastructure. Founder/director of ProjectSafety, a non-profit organization. Larry brings 20 years experience in a variety of local wireline and wireless network....
 

Rob Langhorne

Analytical, highly adaptable professional with extensive experience leading ground-breaking development in mobile computing.and security..
 
     

Chris Rhodes

Principal Software Engineer with over 30 years of experience in systems level software, device drivers, operating systems (desktop & embedded), storage, high performance I/O and distributed systems.
 
     

Khalid Usman

PhD candidate, AI Expert Android and iOS / iPhone application developer
 



ADVISORS
______________


Taher Elgamal

Dr. Elgamal is world renown in the industry as the inventor of Secure Sockets Layer (SSL), a protocol developed by Netscape for transmitting private documents via the Internet. Elgamal also wrote the SSL patent and promoted SSL and has a lifefime achievement award from RSA.
 
     

John Vigouroux

CEO & Co-Founder at Nex Cubed. Former CEO of Cranite Systems and CEO of M86 Security, (acquired by Trustwave) joined as an advisor.
 
     

Manoj Bhatia

Worldwide Sales and Business Development Leader Cisco Systems. Former Director Smart Grid Strategic Alliances, GE Digital Energy.
 

Bill Melendez

Founder and CEO of HEMS Technology, industrial and consumer electronics smart home devices. Expert in sales and sales process.
 
     

Tony Flick

Principle at FYRM Associates. Specializes inApplication Security, Application Architecture, Network Security, Wireless Security, Vulnerability Assessments, Penetration Testing, Social Engineering, Physical Security, Secure Systems.
 
     

Guru Yeleswarapu

Gurumurthy Yeleswarapu has over 20 years of experience in Networking, Security and Mobile technologies. Founded couple of companies Efftronics Inc., (Which was sold in 1999) and e-Colt systems Inc.,...
 



PARTNERS
______________

      



BOUNTY CAMPAIGN
______________



NVIS is going to be a collaborative process. And we need support to make this ICO successful. So you win, we win. A team of skilled professionals has already dedicated a huge amount of their time and knowledge in order to make this happen — and we will continue to do so. With participation in the bounty campaign, you can become a part of the NVIS project.

Anyone can become a shareholder — Initial coin offering (ICO) starts on Aug, 2018. We shall reserve XXX NVIS i.e. NVIS tokens for several bounties, which we will distribute to everyone who supports ICO before and during the ICO.




NVIS

A Distributed Network of VPNs
The Invisible Internet™


Pre-ICO is LIVE
》》》 《《《


WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
SLACKMEDIUMYOUTUBE

7  Local / Токены / ⚫️IonChain⚫️High TPS blockchain⚫️Sharding on: July 07, 2018, 08:08:17 AM
IONCHAIN

Транзакционная система большой емкости


Веб-сайтANNТехническая документацияTELEGRAMTWITTERFACEBOOK
REDDITGITHUBMEDIUMSTEEMIT


❄️    Официальная нить IonChain Bounty    ❄️

Quote
Мы предлагаем нашим участникам кампанию премий IonChain:
10 000 000 IONC токенов = 80 ETH.

========================================
Публичные продажи
Softcap: NO SOFTCAP*
Hardcap: 1 600 ETH


🎉🎉🎉 * Мы продали 35% и заработали 2 333 ETH в ЧАСТНОЙ ПРОДАЖЕ  🎉🎉🎉

⭐️ ICObench ⭐️ 4.0 ⭐️


РАСПИСАНИЕ ОБЩЕСТВЕННОЙ-ПРОДАЖИ
🌟🌟🌟 Открытая распродажа: 27.06.2018 - 03.07.2018 🌟🌟🌟
Открытая распродажа: 04.07.2018 - 11.07.2018 | Цена: 1 ETH = 125 000 IONC

========================================

Другие языки
(Ссылки будут обновлены после перевода)
------------------
.• Корейский: (ANN, Технический документ)
• Индонезийский: (ANN, Технический документ)
• Голландский: (ANN, Технический документ)
• Тайский: (ANN, Технический документ)
• Польский: (ANN, Технический документ)
• Филиппинский: (ANN, Технический документ)
• Японский: (ANN, Технический документ)
• Вьетнамский: (ANN, Технический документ)
• Итальянский: (ANN, Технический документ)
• Датский: (ANN, Технический документ)
• Русский: (ANN, Технический документ)
• Арабский: (ANN, Технический документ)
• Испанский: (ANN, Технический документ)
• Румынский: (ANN, Технический документ)
• Болгарский: (ANN, Технический документ)
• Греческий: (ANN, Технический документ)
• Турецкий: (ANN, Технический документ)
• Хорватский: (ANN, Технический документ)
• Немецкий: (ANN, Технический документ)
• Португальский: (ANN, Технический документ)
• Словенский: (ANN, Технический документ)
• Хинди: (ANN, Технический документ)
• Французский: (ANN, Технический документ)
• Китайский упрощенный: (ANN, Технический документ)




ЗАДАЧА
______________


С увеличением числа децентрализованных блоков, таких как Ethereum и Bitcoin, растет количество других распределенных бухгалтерских технологий. Поскольку объем электронных транзакций растет в глобальном масштабе, становится ясно, что существует потребность в увеличении количества сетей на основе блокчейнов, чтобы не отставать от спроса. Тот факт, что основные блокировки имеют настоящую проблему при обработке большого объема транзакций, которые они видят, свидетельствует о необходимости создания большего количества платформ.



РЕШЕНИЕ
______________


Используя новейшие технологии для включения в сеть баз данных, обычно называемых осколками, IonChain принесет большие масштабируемые и распределяемые системы, которые имеют явное преимущество масштабируемости. Это позволит IonChain заполнить пробел на рынке и расти с потребностями предприятий во всем мире. Распределяемая сеть увеличивает возможности IonChain по экспоненте и будет действовать, чтобы интегрировать IONC в общие транзакции. Проблемы Blockchain, к которым будет обращаться IonChain, - это способность масштабирования, безопасности и децентрализации при сохранении быстродействующей службы.



ЦЕЛЬ
______________


Мы изобретаем блокчейн, не жертвуя децентрализацией или безопасностью.
Познакомьтесь с нашей инновационной двухслойным блокчейном
 - ION CHAIN

         • Двухслойная блок-цепочка (ION CHAIN)
ЦЕПЬ ION CHAIN состоит из эластичного осколка на первом слое и блок-цепи основания для подтверждения блоков из первого слоя.

•Перекрестные транзакции ION CHAIN
Полностью поддерживаются транзакции с перекрестными помехами

• Суперполный узел
Несколько честных узлов могут работать как супер-полный узел

• Двойная защита расходов
По меньшей мере 50% хэш-мощности распределяется на базовую блок-цепочку (root) для предотвращения двойной траты расходов



КАК ЭТО РАБОТАЕТ
______________



  Принципы дизайна IonChain, включая увеличение масштабируемости, но в то же время гарантирующие, что децентрализация и безопасность имеют первостепенное значение. Создание прозрачных межсетевых транзакций с целью обеспечения качества обслуживания пользователей (QoE) в экосистеме, стимулирующей стимулирование, является ключом к IonChain, способным поддерживать различные платформы и предоставлять пользователям удобную учетную запись. Наш дизайн позволит обеспечить масштабируемость в соответствии с требованиями обеспечения высокой безопасности с хорошим уровнем децентрализации.

• Важной основной особенностью сети IonChain является то, что она была  изначально разработана с учетом масштабируемости.
• Горизонтальная масштабируемость. Сеть запускает каждый узел как супер полный узел, который обеспечивает такой же уровень защиты от вредоносных атак, как и традиционные блоксхемы.
• Сеть проста в использовании, безопасна и позволяет публичному участию со связью слабых рабочих.
    IonChain создал концепцию разделения и покорения, которая разделяет функции на два разных уровня, что способствует повышению масштабируемости при сохранении соответствующих уровней безопасности. Используя слой упругого осколка в блочной цепи, меньшие осколки будут перечислены внутри слоев, а количество осколков увеличит способность обрабатывать их одновременно, тем самым увеличивая пропускную способность системы. Сеть содержит базовую цепочку, которая будет подтверждать все блокчэйн блокированные блоки, но не будет обрабатывать транзакции. Он также будет иметь уровень сложности, который не позволит кому-либо отказаться от транзакции, поскольку это не будет экономически эффективно. Платформа предназначена для поддержки дополнительных осколков, которые смогут самостоятельно обрабатывать подмножества транзакций.
Поскольку сеть IonChain является более децентрализованной, чем другие блокирующие системы, уровень безопасности также намного выше, при этом 50% распределения хеш-памяти приходится на базовую цепочку. Технология Sharding позволяет повысить пропускную способность в зависимости от того, сколько транзакций нужно обрабатывать, оптимизируя время с легкостью. Это полезно для:
    • Позволяет сети масштабироваться по мере необходимости без ущерба для времени или эффективности.
    • Создание более высокого уровня децентрализации, чем нормальная цепочка.
    • Безопасность создается за счет поддержания 50% хэш-мощности в базовой цепочке.


Система Ionchain:
   1. Интеллектуальные контракты - смарт-контракты будут облегчены посредством виртуальной машины Ethereum, поскольку в настоящее время она наиболее широко используется.
    2. Вкл. И Выкл. Цепочные транзакции - транзакции с цепочкой размещаются в периоды, когда транзакции должны получить доступ к информации, которая не находится на блочной цепочке. Учетные данные по Smart-контракту могут быть отложены по мере необходимости.
    3. Управление учетной записью упрощается, позволяя одной учетной записи иметь доступ ко всем осколкам. Пользователи могут использовать основную учетную запись, которая содержит адрес пользователя в облоре по умолчанию, или через вторичную учетную запись, которая управляет всеми другими адресами пользователя в осколке. Первичная учетная запись будет использоваться главным образом, а затем будет временно перенесена на адрес во второй учетной записи, если потребуется, при этом любой оставшийся остаток на вторичной учетной записи будет перемещен обратно в основную учетную запись.







ПЛАН ДЕЙСТВИЙ
______________


.
Март 2018
Начало разработки IonChain.
.    Май 2018
   Распределение токенов.

.
Июнь 2018
Развитие.
.    Август 2018
   Расширение команды.

.
Октябрь 2018
Testnet 0.1.
.    Декабрь 2018
   Smart Contract 0.1.

.
Январь 2019
Testnet 1.0 и Smart Contract 1.0n.
.    Май 2019
       Дальнейшее расширение команды.                  

.
Июнь 2019
Формирование компании/юридически.
.  Октябрь 2019
   Ion Chain Mainnet 1.0.

.
Декабрь 2019
Ion Chain Core 1.0.



ДЕТАЛИ ТОКЕНА
______________

.Название:Ionchain token
.Код:IONC
.Платформа:Ethereum -> Ionchain
.Общий объем поставок:1 000 000 000
.Softcap:NO SOFTCAP
.Hardcap:1 600 ETH
.Продажа токенов:07.07 - 14.07
.Принятая покупка:  ETH
.Ценв:1 ETH = 125 000 IONC
.Минимальные инвестиции:   0.1 ETH
.Максимальные инвестиции:   1.6 ETH
.Максимальное количество участников:   1000 (выбирается лотерей)
.Страна:Финляндия
.Документация/KYC:Да
.Ограничение по странам:США, Китай, Сингапур



РАСПРЕДЕЛЕНИЕ ТОКЕНОВ
______________


.Частная продажа (блокировка до 1 года)
|||||||||||||||||||||||||||||||||||   35%
.
.Майнинг, будущее сообщество    
||||||||||||||||||||||||||||||   30%
.
.Публичная продажа (без блокировки) 
||||||||||||||||||||   20%
.
.Команда (блокировка до 1 года)  
||||||||||   10%
.
.Завершение распределения ранних сторонников. 
|||   3.3%
.
.Bounty, награды  
||   1.7%



ГЛАВНАЯ КОМАНДА ION CHAIN
______________



Chong Wang
Основатель, системы масштабирования и производительности
 
   

Ding Jong
Научный сотрудник
 
   

Qian Lim
Инженер-программист
 
   

Xiaole Wu
Блокчайн
 

Mika Kojo
Сотрудник отдела маркетинга
 
   

Elina Nousianen
Старший инженер-программист
 
   

Sanna Rinne
Разработчик программного обеспечения
 
   

Jani Terttu
Менеджер сообщества
 


Tuomas Luosma
Инженер-программист


BOUNTY КАМПАНИЯ
______________



IonChain будет совместным процессом. И нам нужна поддержка, чтобы сделать этот ICO успешным. Итак, ты побеждаешь, я побеждаю. Команда квалифицированных специалистов уже посвятила огромное количество своего времени и знаний, чтобы это произошло, - и мы будем продолжать это делать. Благодаря участию в кампании по щедрости вы можете стать частью проекта IonChain.

Любой может стать акционером - Первоначальное предложение по монетам (ICO) начинается 07 июля 2018 года. Мы зарезервируем 10 000 000 IONC, т. е. Токены IONC для нескольких щедростей, которые мы будем распространять среди всех, кто поддерживает ICO до и во время ICO.
ОБЩИЙ BOUNTY: 10 000 000 IONC

 
      +   Кампания для переводчик: 20%
     2 000 000 IONC ~ 16 ETH
 
+   Рекламная кампания: 20%
     2 000 000 IONC ~ 16 ETH
 
+   Форум кампания: 20%
     2 000 000 IONC ~ 16 ETH
      +   Facebook кампания: 20%
     2 000 000 IONC ~ 16 ETH
 
+   Twitter кампания: 20%
     2 000 000 IONC ~ 16 ETH



IONCHAIN

Транзакционная система большой емкости


WEBSITEANNWHITEPAPERTELEGRAMTWITTERFACEBOOK
REDDITGITHUBMEDIUMSTEEMIT
8  Local / Токены / [BOUNTY][RAISED 2 333 ETH]⭐️10M IONC ⚫️IonChain⚫️High TPS blockchain⚫️Sharding on: July 06, 2018, 03:13:26 PM

IONCHAIN

Транзакционная система большой емкости


Веб-сайтANNТехническая документацияTELEGRAMTWITTERFACEBOOK
REDDITGITHUBMEDIUMSTEEMIT


❄️    Официальная нить IonChain Bounty    ❄️

Quote
Мы предлагаем нашим участникам кампанию премий IonChain:
10 000 000 IONC токенов = 80 ETH.

========================================
Публичные продажи
Softcap: NO SOFTCAP*
Hardcap: 1 600 ETH


🎉🎉🎉 * Мы продали 35% и заработали 2 333 ETH в ЧАСТНОЙ ПРОДАЖЕ   🎉🎉🎉

⭐️ ICObench ⭐️ 4.0 ⭐️


РАСПИСАНИЕ ОБЩЕСТВЕННОЙ-ПРОДАЖИ
🌟🌟🌟 Открытая распродажа: 27.06.2018 - 03.07.2018 🌟🌟🌟
Открытая распродажа: 04.07.2018 - 11.07.2018 | Цена: 1 ETH = 125 000 IONC

========================================

Другие языки
(Ссылки будут обновлены после перевода)
------------------
.• Корейский: (ANN, Технический документ)
• Индонезийский: (ANN, Технический документ)
• Голландский: (ANN, Технический документ)
• Тайский: (ANN, Технический документ)
• Польский: (ANN, Технический документ)
• Филиппинский: (ANN, Технический документ)
• Японский: (ANN, Технический документ)
• Вьетнамский: (ANN, Технический документ)
• Итальянский: (ANN, Технический документ)
• Датский: (ANN, Технический документ)
• Русский: (ANN, Технический документ)
• Арабский: (ANN, Технический документ)
• Испанский: (ANN, Технический документ)
• Румынский: (ANN, Технический документ)
• Болгарский: (ANN, Технический документ)
• Греческий: (ANN, Технический документ)
• Турецкий: (ANN, Технический документ)
• Хорватский: (ANN, Технический документ)
• Немецкий: (ANN, Технический документ)
• Португальский: (ANN, Технический документ)
• Словенский: (ANN, Технический документ)
• Хинди: (ANN, Технический документ)
• Французский: (ANN, Технический документ)
• Китайский упрощенный: (ANN, Технический документ)



Используя новейшие технологии для включения в сеть баз данных, обычно называемых осколками, IonChain принесет большие масштабируемые и распределяемые системы, которые имеют явное преимущества масштабируемости. Это позволит IonChain заполнить пробел на рынке и расти вместе с потребностями предприятий во всем мире. Распределяемая сеть увеличивает возможности IonChain по экспоненте и будет действовать, чтобы интегрировать IONC в общие транзакции. Проблемы Blockchain, к которым будет обращаться IonChain, - это способность масштабирования, безопасности и децентрализации при сохранении быстродействующей службы.

⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️

IonChain начинает  “80 ETH - Официальная программа Bounty”
чтобы вознаградить сторонников IONIC токенов.
 
Программа будет работать до конца ICO (14.07.2018)
 
📌📌📌 [ Текущая неделя: 27/06/2018 to 03/07/2018 ] 📌📌📌
 
Выдача будет выплачена в течение 30 дней после окончания ICO
По всем вопросам обращайтесь в MS Bounty Support
ИЛИ
сообщение на тему нитей, и мы ответим вам с решением


⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️⭐️

ОБЩИЙ BOUNTY: 10 000 000 IONC
 
      +   Кампания для переводчиков: 20%
     2 000 000 IONC ~ 16 ETH
 
+   Рекламная кампания: 20%
     2 000 000 IONC ~ 16 ETH
 
+   Форумная кампания: 20%
     2 000 000 IONC ~ 16 ETH
      +   Facebook кампания: 20%
     2 000 000 IONC ~ 16 ETH
 
+   Twitter кампания: 20%
     2 000 000 IONC ~ 16 ETH

УСЛОВИЯ И ПОЛОЖЕНИЯ
 
• Присоединитесь к IonChain Telegram.
   • Присоединяйтесь к поддержке MS Bounty.
   • Каждая неделя длится со среды по вторник.
   • Мы оставляем за собой право ограничить количество участников для любой из кампаний.
   • Мы оставляем за собой право изменить условия нашей кампании по поощрению.
   • Только одна учетная запись на одного человека.
   • Использование мультисчетов, обман и спам не допускаются.
   • Мы будем проверять все, что мы считаем подделкой или мошенничеством, и оставляем за собой право удалить вас из любой кампании в любое время, если мы считаем, что вы не честны, или присутствует спам на форуме.
   • Мы оставляем за собой право удалить вас из любой кампании без каких-либо объяснений.
   • Если мы по какой-либо причине удалим вас из кампании, мы оставляем за собой право удалить ваши награды.
   • Распределение токенов участникам конкурса будет происходить после окончания ICO. Фактическое количество токенов, которые вы получите, будет определено в момент такого распределения.





КАМПАНИЯ ДЛЯ ПЕРЕВОДЧИКОВ
______________

Quote
2 000 000 IONC ~ 16 ETH ждут профессиональных иностранных переводчиков /модераторов

Задачи и награды:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
    • ANN thread Перевод: 500 ставок
    • Обновление + Модерация / Управление. ANN: 10 ставок на действительную должность.
    • Перевод статьи: 100 ставок на статью
Участвовать:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  1. Присоединиться к IonChain Telegram.
  2. Присоединиться к MS Bounty Support.
  3. Заполните форму: ОТКРЫТАЯ РЕГИСТРАЦИЯ
  4. Проверьте эту таблицу, чтобы отслеживать запись: ТАБЛИЦА ПЕРЕВОДЧИКА

Не стесняйтесь задавать любые вопросы в   IonChain Telegram & MS Bounty Support.

Правила и условия:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  • Переводы должны быть правильными в грамматике и лексике.
   • Перевод должен быть оригинальным, без перевода Google. Если мы обнаружим, что текст переведен с помощью инструментов автоматического перевода, переводчик будет занесен в черный список, и платежи не будут произведены
   • Мы не нуждаемся ни в одной мертвой теме. Если вам не удалось сохранить поток в актуальном состоянии, ваша награда может быть уменьшена до 50% от фактического платежа или вы можете просто быть дисквалифицированы.
   • Если в переводе будет много ошибок, переводчик будет занесен в черный список, и никаких платежей не будет
   • Ожидается, что переводчики будут продолжать обсуждать IonChain по теме, специфичной для их языка.





РЕКЛАМНАЯ КАМПАНИЯ
______________

Quote
2 000 000 IONC ~ 16 ETH ждут впечатляющие статьи и видео

Задачи и награды:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
Разместите слово с оригинальным контентом и заработайте IONC Tokens: Blogging / Video о IonChain.
Все блоги и медиа-контент будут разделены на 6 различных категорий и будут вознаграждены следующим образом:
   • Отлично: 250 долей
   • Высокий: 200 ставок
   • Хорошо: 100 ставок
   • Средняя: 50 долей
   • Обычный: 25 ставок
   • Низкий: 10 долей

 

Участвовать:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  1. Присоединиться к IonChain Telegram.
  2. Присоединиться к MS Bounty Support.
  3. Заполните форму: ОТКРЫТАЯ РЕГИСТРАЦИЯ
  4. Проверьте эту таблицу: Рекламное содержание

Правила и условия:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  • Не копируйте предыдущие статьи участников.
  • В приоритете популярных и уважаемых СМИ.
  • Все тексты должны быть опубликованы онлайн и доступны для всех.
  • Ваш текст должен быть уникальным.
  • Мы не разрешаем веб-сайты без аудитории или новых веб-сайтов; веб-сайту, на котором вы хотите опубликовать свой текст, должен быть не моложе 2 месяцев и должен активно использоваться.
  •   Ваш текст должен содержать не менее 500 слов.
  •   Видео должно длиться не менее  2:00 минут. Короче, чем это не будет принято.
  •   Ваша должность должна включать как минимум 2 ссылки : на http://ionchain.io/ веб-сайт, IonChain ANN нить https://bitcointalk.org/index.php?topic=3641957.0,другие социальные сети IonChain или другие статьи о проекте.
  •   Убедитесь, что у вас есть полное понимание IonChain. Прочтите проект IonChain.
  •   Технический документация ее вы можете найти на нашем веб-сайте http://ionchain.io/
  •   Весь контент будет оцениваться на основе качества, трафика, просмотров и влияния.

Не стесняйтесь задавать любые вопросы в   IonChain Telegram & MS Bounty Support.



FACEBOOK КАМПАНИЯ
______________

Quote
2 000 000 IONC ~ 16 ETH ждут поддержки

Задачи и награды:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  •   Разделяет наши сообщения и создавайте уникальные сообщения об IonChain на вашей временной линии и в группе Crypto. Ставки будут рассчитываться на основе количества подписчиков / друзей:
      Подписчики / Друзья    
300 - 500
501 - 1000
1001 - 2000
2001 - 3000
3001 - 4000
4001+
  Ставки за сообщение
2
3
4
6
8
10
 • Опубликовать / поделиться в группах Crypto из более чем 10 000 участников: 5 долей за сообщение.
 
Участвовать:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  1. Присоединиться к IonChain Telegram.
  2. Присоединиться к  MS Bounty Support.
  3. Поставьте лайк и подпишитесь на официальную страницу : https://www.facebook.com/chainion/
  4. Заполните форму: ОТКРЫТАЯ РЕГИСТРАЦИЯ
  5. Проверьте эту таблицу: FACEBOOK ССЫЛКА
 
Не стесняйтесь задавать любые вопросы в   IonChain Telegram & MS Bounty Support.
 
Правила и условия:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
 • Вы должны делиться не менее чем 5 сообщениями из нашего аккаунта Facebook за неделю
  • Вы должны сделать как минимум 2 уникальных сообщения в неделю с вашим номером электронной таблицы + #IonChain #IONC и ссылкой либо на страницу ANT BTT (https://bitcointalk.org/index.php?topic=3641957), нить Bounty ( ссылка) или веб-сайт IonChain (http://ionchain.io/). Если сообщение не содержит одну из этих ссылок, это будет считаться недействительным.
  • Не более 1 акции в Crypto Group, 1 акция и 1 сообщение будут засчитываться в день.
  • Должности должны быть на английском языке.
  • Все сообщения будут рассматриваться еженедельно со среды по вторник 23:59 по Гринвичу.
  • Создавайте только 1 новую должность каждую неделю в Bounty Thread, чтобы сообщить о своей работе до вторника 23:59 GMT. В противном случае не будет дано никакого результата.
  • ADD (d / m) ссылок и НЕ цитируйте старые отчеты.
  • Часто проверяйте поток Bounty & Spreadsheet для обновления.


Code:
#Report Facebook
Week [27/6 - 3/7]
Bitcointalk Username:
Spreadsheet No:
Public post (min 2 per week ):
1. (d/m)
2. (d/m)
...

Like & Share (min 5 per week)
1. (d/m)
2. (d/m)
...
 
Post in Crypto group (>10 000 members):
1. (d/m)
2. (d/m)
...




TWITTER КАМПАНИЯ
______________

Quote
2 000 000 IONC ~ 16 ETH ждут поддержки

Задачи и награды:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  •  Подпишитесь на наши сообщения и новости о IonChain. Ставки будут рассчитываться на основе количества Последователей:
      Подписчики
300 - 500
501 - 1000
1001 - 2000
2001 - 3000
3001 - 4000
4001+
  Ставки за сообщение
2
3
4
6
8
10

Участвовать:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  1. Присоединиться к IonChain Telegram.
  2. Присоединиться к MS Bounty Support.
  3. Поставьте лайк и подпишитесь на официальный Twitter: https://twitter.com/ion_chain
  4. Заполните форму: ОТКРЫТАЯ РЕГИСТРАЦИЯ
  5. Проверьте эту таблицу: TWITTER ССЫЛКА
 
Не стесняйтесь задавать любые вопросы в IonChain Telegram & MS Bounty Support.
 
Правила и условия:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
 • Вы должны ставить лайки и перепостить по крайней мере 5 твитов из нашей учетной записи в Twitter за неделю
  • Вы должны сделать как минимум 2 уникальных твита в неделю с вашим номером электронной таблицы + #IonChain #IONC и ссылкой либо на страницу BTN ANN (https://bitcointalk.org/index.php?topic=3641957), нить Bounty ( ссылка) или веб-сайт IonChain (http://ionchain.io/). Если твит не включает одну из этих ссылок, это будет считаться недействительным.
  • Не более 1 ретвита + 1 твит будет засчитан в день.
  • Твиты должны быть на английском языке.
  • Все твиты / ретвиты будут рассматриваться еженедельно со среды по вторник 23:59 по Гринвичу.
  • Создавайте только 1 новую должность каждую неделю в Bounty Thread, чтобы сообщить о своей работе до вторника 23:59 GMT. В противном случае ставки не будут выплачиваться.
  • ADD (d / m) ссылок и НЕ цитируйте старые отчеты.
  • Часто проверяйте поток Bounty & Spreadsheet для обновления.

 
Code:
#Report Twitter
Week [27/6 - 3/7]
Bitcointalk Username:
Spreadsheet No:
Tweet (min 2 per week ):
1. (d/m)
2. (d/m)
...
 
Like & Retweet (min 5 per week):
1. (d/m)
2. (d/m)
...
 




ФОРУМ
______________

Quote
2 000 000 IONC ~ 16 ETH ждут поддержки

Задачи и награды:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  •   ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
   • Подпись / аватар Bitcointalk: добавьте подпись / аватар IonChain на свою учетную запись Bitcointalk / Altcoinstalks на время ICO и сделайте не менее 8 действительных сообщений в неделю:

           + Hero/Legendary: 50 долей в неделю
           + Sr. Member: 40 долей в неделю
           + Full Member: 30 долей в неделю
           + Member: 20 пакетов акций в неделю
           + Jr. Member: 10 пакетов акций в неделю
           + Newbie: 5 пакетов акций в неделю
       Бонус: +10 долей, если вы носите наш аватар.
 
Участвовать:
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
  1. Присоединиться к   IonChain Telegram.
  2. Присоединиться к MS Bounty Support.
  3. Запо
Pages: [1]
Sponsored by , a Bitcoin-accepting VPN.
Powered by MySQL Powered by PHP Powered by SMF 1.1.19 | SMF © 2006-2009, Simple Machines Valid XHTML 1.0! Valid CSS!