Bitcoin Forum
October 01, 2024, 04:14:05 AM *
News: Latest Bitcoin Core release: 27.1 [Torrent]
 
   Home   Help Search Login Register More  
Pages: [1] 2 3 4  All
  Print  
Author Topic: [ANN] NVIS - Invisible internet - Pre-ICO Jun. 20 - Aug. 31  (Read 659 times)
shakhana (OP)
Jr. Member
*
Offline Offline

Activity: 53
Merit: 1


View Profile
July 24, 2018, 08:34:48 AM
Last edit: July 30, 2018, 08:44:17 AM by shakhana
 #1


NVIS

A Distributed Network of VPNs
The Invisible Internet™


Pre-ICO is LIVE
》》》 《《《


WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
SLACKMEDIUMYOUTUBE


🔊    Official NVIS ANN thread    🔊

Official NVIS Bounty campaign : NVIS Tokens (~1000 ETH) are waiting for you!
https://twitter.com/BountyTreesDrop/status/1013576501676081154

========================================
ICO CAPS

Softcap: 500 ETH
Hardcap: 5 000 ETH




TOKEN SALE SCHEDULE

🌟🌟🌟 Pre-Sale: 20.06.2018 - 31.08.2018 | Price : 1 NVIS = 0.012-0.017 ETH 🌟🌟🌟
Main-Sale: N/A | Price : N/A

========================================

Other Languages
(Links will be updated after the translation)
------------------
.• Chinese : (ANN, Whitepaper)
• Arabic : (ANN, Whitepaper)
• Japanese : (ANN, Whitepaper)
• Russian : (ANN, Whitepaper)
• Korean : (ANN, Whitepaper)
• Spanish : (ANN, Whitepaper)
• Vietnamese : (ANN, Whitepaper )
• German : (ANN, Whitepaper )




PROBLEM
______________


Despite the blockchain scale, nodes are individually subject to Denial of Service attacks that can take down strategically significant nodes and risk overwhelming other nodes as transactions are processed suboptimally. Vulnerabilities in TCP/IP network services can be a major weakness in blockchain networks. Network vulnerability scanners, such as Nessus by Tenable, and online databases, including Common Vulnerabilities and Exposures (CVE) contain thousands of publicly known vulnerabilities, exploits, backdoors, and trojans in network services and applications. The Internet is founded on TCP/IP, and the vast body of network implementations and applications make it infeasible to use other protocols. Because of the diversity of hosts and network configurations, each blockchain node is managed by different individuals and organizations that have wide variance in the level of sophistication of administrators with respect to network security.

More of our lives are transferred onto the Internet daily. This creates more opportunity for our data to be stolen, hacked, filtered or misused. Privacy has become almost impossible. There is also increased data vulnerability. One of the main forces driving the market for privacy and security solutions is the vast market to collect or steal and sell personal information.

VPN can be used to provide a security layer to both private and public networks such as WiFi Hotspots and the Internet. Organizations operating in healthcare and telecommunication industry deal with sensitive information that needs to be protected constantly. Hackers are mostly targeting these industries due to very high price of data in black market. The same study shows that “currently, the world is experiencing more than half million attacks every minute, which will rise due to high technology proliferation”.





SOLUTION
______________


The solution NVIS proposes is to have a blockchain with integrated peer-to-peer Layer 2 encryption between nodes. Product, SafeConnect L2P2P is a layer 2 over layer 3 VPN so from the inner perspective of the node, all ports are available.

From the outer perspective of the node (the Internet side), all TCP ports are closed and filtered by iptables, except for the port used as a funnel for communication with a named community of peers.

The benefits of this architecture include:

   ●   Reducing the outside attack surface
   ●   Cloaking inter-node communication
   ●   Normal intra-node communication
   ●   Sealing all unused ports
   ●   Eliminating threat of external packet-injection
   ●   Improves the uptime and performance of blockchain nodes




HOW IT WORKS
______________

VPN service consumer find and pay service providers in TLC SafeConnect Network by using built-in smart contract based Identity, Service Discovery and Payment services. The network itself is cloaked, and nodes use the Ethereum blockchain for censorship resilient distributed storage and transactional processing needs. The TLC SafeConnect Network will use Registered Identities to enable means of creating limited trust when engaging with services and account payments.


Core components:

   ➢   Ethereum allows the TLC SafeConnect Network to run decentralized code with smart contracts, enabling reliable services and payment handling.
   ➢   Identity service and database of registered identities will be added to ensure the proper identity acknowledgement between client and service provider.
   ➢   Discovery service and database of available services will be created to announce VPN services availability.
   ➢   Payment service and database of balances will be developed to secure promise-based micropayments for services.



00000000000000000000000000000


00000000000000000000000000000


00000000000000000000000000000

Decentralized
The TLC Secure Network VPN is powered by SafeConnect, a L2P2P networking. Infinitely Scalable. with a peer to peer connection, there is no single point of failure.
Open Source
In order to maintain network transparency, the source code is 100% visible so we can continue to improve as a community. Join our team on GitHub or Slack.
Secure
The core of the network is based off of the SafeConnect VPN which has been operated & industry test. A powerful network that ensures secuirty on a commercial scale.



VALUE PROPOSITIONS
______________


Security: Joining TSN gives users an "invisibility cloak" for host computers, protecting vital system services (such as blockchain nodes, web services and data sources) from port and protocol hacking and costly, disruptive DDoS attacks or theft. Hackers can't hack what they can't see.

Privacy: This will be a key competitive edge as well as core service of TSN. Participating nodes will have the ability to switch off the public Internet and use only TSN, or Communities they join or create. This means your shared services can reach just your group, or millions. Ideal for finance and ad-hoc networks for smart contracts and trading partner agreements that MUST be private.

The Invisible Internet: TSN will have it's own DNS, DHCP and IP management, with it's own domain name registration service and distributed firewalls.  In effect, it will be a brand new Internet. This offers boundless entrepeneurial opportunities for auction and sale of high value domains.

Want google.com ? You can own it on TSN.

Content:  You can provide ANYTHING and do EVERYTHING. The unique community name feature of TSN will allow for Content Marketing. Operate a marketplace,  or stream video, music and audio, TSN has opportunities for negotiation with premium content providers to accept NVIS as a universal access token for pay-per-view or subscriptions. This will allow TSN to become similar to a global cable service for a vast range of programs and online events.


   



ROADMAP
______________


Pre-ICO: 20 June 2018 - 1 August 2018

Tokens will be distributed to represent 10% of the supply and the price of the ICO.


Trading capability:  August 2018

Convenient NVIS smartphone wallets and listing on exchanges will permit NVIS to expand market capitalization.


Initial Coin Offering: August 2018

30% of the tokens will be distributed to solve the capital issue so that we can improve and expand the network.


Token redeeming:  Fall 2018

After the ICO, private blockchain use-tokens issued for bounties, etc. can be redeemed for NVIS trading tokens. This will allow us to offer high value services.


Blockchain hosting: late 2019

The launch of services related to blockchain hosting and alternative crypto token support.


New type of money: 2020

The synergy between blockchain hosting and payment products will offer new types of services linked usage tokens as a medium of exchange.




TOKEN DETAILS
______________

The internal cryptocoin will be used to access the network and to pay for premium services and content. The ecosystem for token use is:
● End Users TSN will pay users with NVIS tokens for access. They may purchase NVIS for premium content and services.
● Miners Earn various utility tokens on the TLC Secure Private Blockchain from PoW
● Node Operators will be given NVIS incentives to add nodes/recruit other operators of other blockchains.

.Token name:Invisible Internet
.Ticker:NVIS
.Platform:Ethereum
.Type:Utility
.Total supply:100 000 000 NVIS
.Softcap:500 ETH
.Hardcap:5 000 ETH
.Token Sale:20.06 - N/A
.Accepted purchase:  ETH, BTC
.Price:1 NVIS = 0.012 - 0.017 ETH
.Minimum investment:    0.1 ETH
.Whitelist/KYC:Yes
.Restricted areas:USA, China, Korea, Pakistan



TOKEN ALLOCATION
______________


.Pre-sale   
|||||   5%
.Private-Sale   
||||||||||   10%
.Public sale   
|||||||||||||||||||||||||   25%
.Bounties and advisors   
|||||   5%
.Team and planned employees   
||||||||||||||||||||   20%
.Reserve for Future Expansion   
|||||||||||||||||||||||||   25%
.Founders   
||||||||||   10%



FUNDS DISTRIBUTION
______________


.Core development     
||||||||||||||||||||||||||||||||||||||||   40%
.Operational   
|||||||||||||||||||||||||   25%
.Marketing and sales   
|||||||||||||||||||||||||   25%
.Legal and compliance   
||||||||||   10%



TOKEN SALE
______________


.
PHASE

          Pre-ICO         
Token-Sale
DURATION

             20.06 - 01.08             
N/A
TOKEN AVAILABLE

       2 500 000 NVIS       
N/A
PRICE

       1 NVIS = 0.012 - 0.017 ETH       
N/A
SOFTCAP

       500 ETH       
N/A



CORE TEAM
______________

TLC Secure, Inc. is a network security products and consultancy startup in Northern California, USA. Among our products is WirelessWall, a proven, multi-platform FIPS certified layer 2 encryption technologies used by government and large enterprises to secure wireless campus and sensor networks. We also created SafeConnect, an award-winning fast, efficient layer 2 over layer 3 VPN with built-in firewall.


Phil Smith
CTO
Phil is Founder and chief architect with expertise in security, networking, ISP and blockchain. He has overr 30 years in lead roles at NASA, HP, Cisco, Lawrence Livermore National Lab and other research labs and commercial projects as well as Space Shuttle and satellite communications and large network projects.
 
     

John Matthesen
CEO
John is a serial entrepreneur, with global operations and sales experience in the US, Europe and Asia. As part of the startup teams at Sybase and Commerce One, he held numerous positions, including CIO, VP of Asia...
 
     

Larry Karisny
CBDO
Larry is an author and expert in Smart Grid and critical infrastructure. Founder/director of ProjectSafety, a non-profit organization. Larry brings 20 years experience in a variety of local wireline and wireless network....
 

Rob Langhorne

Analytical, highly adaptable professional with extensive experience leading ground-breaking development in mobile computing.and security..
 
     

Chris Rhodes

Principal Software Engineer with over 30 years of experience in systems level software, device drivers, operating systems (desktop & embedded), storage, high performance I/O and distributed systems.
 
     

Khalid Usman

PhD candidate, AI Expert Android and iOS / iPhone application developer
 



ADVISORS
______________


Taher Elgamal

Dr. Elgamal is world renown in the industry as the inventor of Secure Sockets Layer (SSL), a protocol developed by Netscape for transmitting private documents via the Internet. Elgamal also wrote the SSL patent and promoted SSL and has a lifefime achievement award from RSA.
 
     

John Vigouroux

CEO & Co-Founder at Nex Cubed. Former CEO of Cranite Systems and CEO of M86 Security, (acquired by Trustwave) joined as an advisor.
 
     

Manoj Bhatia

Worldwide Sales and Business Development Leader Cisco Systems. Former Director Smart Grid Strategic Alliances, GE Digital Energy.
 

Bill Melendez

Founder and CEO of HEMS Technology, industrial and consumer electronics smart home devices. Expert in sales and sales process.
 
     

Tony Flick

Principle at FYRM Associates. Specializes inApplication Security, Application Architecture, Network Security, Wireless Security, Vulnerability Assessments, Penetration Testing, Social Engineering, Physical Security, Secure Systems.
 
     

Guru Yeleswarapu

Gurumurthy Yeleswarapu has over 20 years of experience in Networking, Security and Mobile technologies. Founded couple of companies Efftronics Inc., (Which was sold in 1999) and e-Colt systems Inc.,...
 



PARTNERS
______________

      



BOUNTY CAMPAIGN
______________



NVIS is going to be a collaborative process. And we need support to make this ICO successful. So you win, we win. A team of skilled professionals has already dedicated a huge amount of their time and knowledge in order to make this happen — and we will continue to do so. With participation in the bounty campaign, you can become a part of the NVIS project.

Anyone can become a shareholder — Initial coin offering (ICO) starts on Aug, 2018. We shall reserve XXX NVIS i.e. NVIS tokens for several bounties, which we will distribute to everyone who supports ICO before and during the ICO.




NVIS

A Distributed Network of VPNs
The Invisible Internet™


Pre-ICO is LIVE
》》》 《《《


WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
SLACKMEDIUMYOUTUBE

MrSpasybo
Member
**
Offline Offline

Activity: 378
Merit: 19


View Profile
July 24, 2018, 03:32:29 PM
 #2

Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?
ferrari4luv
Newbie
*
Offline Offline

Activity: 39
Merit: 0


View Profile
July 24, 2018, 08:10:15 PM
 #3

Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?

I have been following this project for a while and I can attest to the fact that this is one of the most transparent and legit projects, aimed to protect both individual and corporate profiles on the internet/intranet. All it needs is more publicity on how it works.
MrSpasybo
Member
**
Offline Offline

Activity: 378
Merit: 19


View Profile
July 25, 2018, 12:09:32 AM
 #4

Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?

I have been following this project for a while and I can attest to the fact that this is one of the most transparent and legit projects, aimed to protect both individual and corporate profiles on the internet/intranet. All it needs is more publicity on how it works.
I checked their Pre-ICO on KickICO, I think KickICO checked their info too, but I'm waiting for their info and their listing on ICObench/ICOholder/trackICO with high rating scores. At the moment VPN is a part of our life and internet, it is cool if they can bring it to blockchain.
Mr_QuanRuby
Newbie
*
Offline Offline

Activity: 308
Merit: 0


View Profile
July 25, 2018, 04:24:07 AM
 #5

Today’s digital financial markets are growing at an exponential rate and hackers now have more advanced techniques and equipment than ever before.
So, why TSN can resistant to hackers? Why is TSN called the Invisible Internet?
Andrew Clinton
Jr. Member
*
Offline Offline

Activity: 73
Merit: 1


View Profile
July 25, 2018, 10:56:35 AM
 #6

In the context of network security being put at the top of current companies, the solution NVIS offered is entirely feasible and highly applicable. And I think this can be used more extensively!
Mr_QuanRuby
Newbie
*
Offline Offline

Activity: 308
Merit: 0


View Profile
July 25, 2018, 12:58:26 PM
 #7

Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?

I have been following this project for a while and I can attest to the fact that this is one of the most transparent and legit projects, aimed to protect both individual and corporate profiles on the internet/intranet. All it needs is more publicity on how it works.
I checked their Pre-ICO on KickICO, I think KickICO checked their info too, but I'm waiting for their info and their listing on ICObench/ICOholder/trackICO with high rating scores. At the moment VPN is a part of our life and internet, it is cool if they can bring it to blockchain.

The Global Information Security Workforce Study 2017 report from Frost & Sullivan and the International Information Systems Security Certifications Consortium Inc. states that unfilled jobs in Cybersecurity will be over 1.8 million by 2022.
This shows that hacking is a problem hacking is a problem, not only for existing software companies, but also for blockchain companies. This is a problem, I hope NVIS is a solution!
bitcoinbaba01
Newbie
*
Offline Offline

Activity: 294
Merit: 0


View Profile
July 25, 2018, 08:11:28 PM
 #8

VPN on blockchain. Again an unique concept to look for. Need to go in deep to know more about this project and also the team looks strong enough in regards with their experience.
naderba666
Newbie
*
Offline Offline

Activity: 266
Merit: 0


View Profile
July 25, 2018, 08:52:48 PM
 #9

Good concept. Does this project have a bounty campaign? I would love to join for the bounty.
MrSpasybo
Member
**
Offline Offline

Activity: 378
Merit: 19


View Profile
July 25, 2018, 10:46:11 PM
 #10

Good concept. Does this project have a bounty campaign? I would love to join for the bounty.

At the moment there is Ref-program from NVIS: https://twitter.com/BountyTreesDrop/status/1013576501676081154
Hope they have successful Pre-ICO, then thay can launch Bounty-campaign to promote project to crypto-community.
londonaddict
Newbie
*
Offline Offline

Activity: 62
Merit: 0


View Profile
July 25, 2018, 11:04:51 PM
 #11

This doesn't look super legit..
bitcoinbaba01
Newbie
*
Offline Offline

Activity: 294
Merit: 0


View Profile
July 26, 2018, 06:21:25 AM
 #12

I looked at the road map and I must say its simple and to the point. You guys have already pretty much developed and expanded the project before going into the pre-sale and this is a good sign.
Mr_QuanRuby
Newbie
*
Offline Offline

Activity: 308
Merit: 0


View Profile
July 26, 2018, 08:02:41 AM
 #13

A solid team comprised of technical, business experts and is extremely experienced. I like that. I hope this project will be one of the best in the near future.
MrSpasybo
Member
**
Offline Offline

Activity: 378
Merit: 19


View Profile
July 26, 2018, 04:17:27 PM
 #14

I looked at the road map and I must say its simple and to the point. You guys have already pretty much developed and expanded the project before going into the pre-sale and this is a good sign.
Their roadmap is to 2020, do you think it is short for a crypto/blockchain project? I want to read detailed roadmap, what will they do, which partners do they want to buring VPN to blockchain and issue tokens for payment method.
Andrew Clinton
Jr. Member
*
Offline Offline

Activity: 73
Merit: 1


View Profile
July 26, 2018, 04:32:39 PM
 #15

I think this is a good way to solve network security problems. We are facing many threats, especially when the scientific revolution is exploding. Besides, we see the huge potential of this project. hope the project will succeed
Namyri
Newbie
*
Offline Offline

Activity: 135
Merit: 0


View Profile
July 26, 2018, 04:41:37 PM
 #16

I like this project, I will wait to develop more on this project.
MrSpasybo
Member
**
Offline Offline

Activity: 378
Merit: 19


View Profile
July 26, 2018, 04:48:26 PM
 #17

I think this is a good way to solve network security problems. We are facing many threats, especially when the scientific revolution is exploding. Besides, we see the huge potential of this project. hope the project will succeed
Are you using VPN or fake IP software? Do you think it is save for you and your data?
Just for me: i think it is not save, when VPN can save my history  private key + data, just is save from governments when they can't check my ID.
I worked in FBA, sold products on Amazon, and need to have VPN to online 24/7.
Wait for NVIS solution and their product, not just MVP, after token-sale.
Andrew Clinton
Jr. Member
*
Offline Offline

Activity: 73
Merit: 1


View Profile
July 26, 2018, 05:04:23 PM
 #18

A solid team comprised of technical, business experts and is extremely experienced. I like that. I hope this project will be one of the best in the near future.
yeah, i have the same thought with you. i think the team was doing really well and you can see a brilliant future of this project. moreover, i hope they will succeed!
MrSpasybo
Member
**
Offline Offline

Activity: 378
Merit: 19


View Profile
July 26, 2018, 05:51:02 PM
 #19

VPN is also a centralized model when it is managed by a company with a server cluster, they can steal information from the client. Blockchain technology is the most powerful solution to this problem. Just we need to understand more and more the protocol and how it works for the VPN market.
Tiffanya
Newbie
*
Offline Offline

Activity: 249
Merit: 0


View Profile
July 26, 2018, 06:11:02 PM
 #20

I believe this project has a good future because Zeepin has a complete foundation. I'm taking some great bonuses. good luck!
Pages: [1] 2 3 4  All
  Print  
 
Jump to:  

Powered by MySQL Powered by PHP Powered by SMF 1.1.19 | SMF © 2006-2009, Simple Machines Valid XHTML 1.0! Valid CSS!